Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

Back to all Rat symbols

Rat Or1v2-ps Olfactory Receptor

Gene Symbol Or1v2-ps
Organism Rat
Family 1
Subfamily v
Pseudo Yes
Location chr3:20866965-20867928 (+)
Aliases Olr412-ps

Sequence information


Nucleotide sequence

CATGCTTGTATAAGGCTCTCTTAGGGGTGGAGATTTCCAGGGTAGAGATCAGTAGAATTT
CAAGACACACAGGGAATAATGAGATTTCAAACTCAGGGACATGCTCATCATCCTGTCCAT
TGACTGGACTCTCACCTCCACCCCCATGTATTTCTTTCTCAGCACTTGGTCTTCACAAGA
ATCTTTTTCTCTCATCTGTCACTGTACCTAAGTTGCTGACGGACATGTACACTAATCGTC
ATTTCCATTGGAGGATGATTTTTTTTTTATTTGCTACTGGCCTGAGTGGCTTCCCAGTTA
CATCAATGATGTATGTCCAAAACATCTCCACTCTACCACCATTATGAGAAAATTGGTGCA
TTATGAAAAGTTGTGTTTTAAATCCTGTATAGTGCCAGCCCCTCTCTTGCATCTTCTTAA
CATAGCTGCTGTTCTGTGCTGATGCCATGCTTCTTTTAAGACCTAACTGCCATGATTAAA
TTGGCCTGTTCAGATACCTTCCTCAAAGAATTGGTCATCTTCACAGTCAGGATGGCAGTC
TTTATTTAAGATTTTTATGTATATTGGTATCTTATGGGTACACTGTGGCCACAATTCTGA
GGGGCTCTTCAAATGTGGGAATTTGTAAAGCATTGTGTACATGTAGCTCCCATCTCTCTA
TGCTGTCTCTTTATTATGGGGCTATTTGAACACTACCTTTTCCCAACATCTAATAATATA
ATGGACAAGGACATCATTGTAGCTGTCATGTAAACAGCTGTCATACCCATGTTAAACCTC
TACATTTGTAATTTTAGAAACAGGGATACAAAAGAAGCACTTGGGATATTCTTGTCACAT
AAGAGTCTTTTTATGGCAACATCTGAATATTTTCGTCAAAACTCTATCTTTATTTATAAC
ATGAACTTGACTTCAAACTTGAATGTTTTTTAAAAATTATTTTTGTCCTCAAGCTCTTAG
ACAG


Conceptual translation

MYFFLSTWS\KNLFLSSVTVPKLLTDMYTNRHFHWRMIFFLFATGLSGFPVTSMMYVQN
ISTLPPL*E/LVHYEKLCFKSCIVPAPLLHLLNI/CCSVLMPCFF*DLTAMIKLACSD
TFLKELVIFTVRMAVFI/RFLCILVSYGYTVATILRGSSNVGICKALCTCSSHLSMLSL
YYGAI*TL/F/PTSNNIMDKDIIVAVM*TAVIPMLNLYICNFRNRDTKEALGIFLSHK
SLFMATS