Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

Back to all Rat symbols

Rat Or1x2b Olfactory Receptor

Gene Symbol Or1x2b
Organism Rat
Family 1
Subfamily x
Pseudo No
Location chr10:36517169-36518107 (+)
Aliases Olr1408

Sequence information


Nucleotide sequence

ATGTCCAAGTGGGGAGAGAATGAGACTGGAGTCATTGAGTTTCTCCTGCTTGGCATCACA
AATGACCCACAACAGCAACGAATCCTCTTCTGGGCTTTCCTGTGCATGTACCTGGTCACG
GTGGCTGGGAACACACTCATCTTCCTGGCCATCAGCTCTGACCCGCACTTGCACACCCCC
ATGTATTTCTTCCTTGCTAACCTTTCCTTTGATGATGTCTGCTTCACCACCAATATCATC
CCCAGGCTGTTGGCTGGCCACGTGTCTGGAACGGAGACCATCTCTTATGCCTACTGCCTG
ACTCAGATGTATTTTCTAATTTCCTTTGGAAATGTGGACACCTTTCTGCTTGCTGCCATG
GCACTAGACAGATTTGTGGCCATCTGCTACCCACTACAGTACCACACTATCATAACACCC
CGGCTCTGTGTGGGGCTGGCATCCGTTGTGTGGATAAGCTCTGGGCTCATAGCTCTGGTG
CACACACTCCTCATGAGCAGACTGACCTTCTGTTCCTCCATTCCAGAGATCTCTCACTTC
TACTGTGATGCTTATCTGCTCATGAAGTTGGCCTGTTCAGACACACGGATCAATCAACTT
GTCTTCCTGGGAGCCGTGGTCTTCTTTGTGGCCCCCTGCATTCTCATTGTGTTCTCTTAT
GTCCGAATCGCTATGGCAGTCTTTCAGATACCTTCTGCCAAGGGCAGGCACAAGGCATTT
TCCACGTGTAGCTCCCACTTAACTGTGGTCATTCTGTTCTATGGGACAGTTCTGGGGATC
TACATACGACCTCCAGACTCCTTCTCCACTCAGGACACAGTAGCCACCATCATGTTTACT
GTGGTTACCCCCATGCTGAACCCCTTCATTTACAGCCTGAGGAACAAGGACATGAAGGAG
ACGGTGACAAGGCTCCTCCATAGAGGCTCAAAGTCCTCG


Conceptual translation

MSKWGENETGVIEFLLLGITNDPQQQRILFWAFLCMYLVTVAGNTLIFLAISSDPHLHTP
MYFFLANLSFDDVCFTTNIIPRLLAGHVSGTETISYAYCLTQMYFLISFGNVDTFLLAAM
ALDRFVAICYPLQYHTIITPRLCVGLASVVWISSGLIALVHTLLMSRLTFCSSIPEISHF
YCDAYLLMKLACSDTRINQLVFLGAVVFFVAPCILIVFSYVRIAMAVFQIPSAKGRHKAF
STCSSHLTVVILFYGTVLGIYIRPPDSFSTQDTVATIMFTVVTPMLNPFIYSLRNKDMKE
TVTRLLHRGSKSS