Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

Back to all Rat symbols

Rat Or1y1-ps Olfactory Receptor

Gene Symbol Or1y1-ps
Organism Rat
Family 1
Subfamily y
Pseudo Yes
Location chr10:60764164-60764824 (-)
Aliases Olr1503-ps

Sequence information


Nucleotide sequence

AATCTCTGGACCCGTAAGCCAGCATAAATTGAATGTTGTCTTTAGAAGTGTTGCTTTGGT
CATAGTGTTTGTTTACAGCCATAAATCCATAACTAAGGCATTCATTCACCTGACCTATCT
CCACACATTCATTTACTTGTTAATCAGCAACTTGCCCTTTTCTGACCTCTGCTTTTCCTC
TTTTGCAATGCCCAAATTGCTTCAGAACATTCAGAGTCAGTACACATCCATTCCCCATGT
GGGTGGTCTGAAACAAATATATTTTTAATGGAGATATGGAGAATTTTATGCTTGAGTTAT
GGCCAATGAGCAGAATGTGACCATCTGCTTCCCCTTTCATTACACAGGCTTTCTACACTC
AGCTAGTCTATTGCTGCCATTGTGGATGTTAACCACATTCCGTGCAATGCTGCTTTCAGT
GCTCATGGCAAGATTGTTCCTCCTAACCCCTAAAACCCAATATTTTAATGTAGTTTATCC
AATCTGGCCCAATTTTTCTTGTGTGATGGCAATGAACTCAAGGTGGTGCAGTTCTTTGAG
CAAGTAGCTCCTCTTGATTGAGTGCAGGCTGTAGACGAAGTTGCATGCTCCCTGCTCCTT
GTTCAGTGCCTCCCTGGGCTCCTTCTTGAGATGAGCACCCAGAAGCCAGGGAGTAGGAAT
G


Conceptual translation

TYLHTFIYLLISNLPFSDLCFSSFAMPKLLQNIQSQYTSIPHVGGLKQIYF*WRYGEFYA
*VMANEQNVTICFPFHYTGFLHSASLLLPLWMLTTFRAMLLSVLMARLFLL/P*NPIF*
CSLSNLAQFFLCDGNELKVVQF