Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

Back to all Mouse symbols

Mouse Or2a51 Olfactory Receptor

Gene Symbol Or2a51
Organism Mouse
Family 2
Subfamily a
Pseudo No
Location chr6:43201646-43202584 (+)
Aliases Olfr435, MOR261-5

Sequence information


Nucleotide sequence

ATGAAAGAAAATCAGACAATGGTCACAGAGTTCATCCTGCTGGGATTCTGTCTTGGCCCA
AGAATTCATGTAATTCTTTTTGCATTGTTCTCTGTCTGCTACATCTTTACATTGTTAGGG
AATGGGTTTACCCTTGGGCTAATCTGCCTAGAGCCCAGGCTACACTCTCCTATGTATTTC
TTCCTCTCCAATTTGGCCACTGTTGACATTGCCTATGCCTGCAACACAGTGCCACAAACA
CTGGTAAACCTCTTGGATGAGACCAAGCCCATCTCCTTTGCTGGATGCATGATGCAGACT
TACCTATTTTTGACATTTGGGAGCACAGAATGTGTCCTCCTTGTGGTGATGTCCTATGAT
CGATATGTTGCCATCTGCCACCCCCTACACTACACTGTCATCATGAACTGGAGAGTGTGT
ACCATCATGGCTGCTGTTTCCTGGATATTTAGCTTTCTCCTTGCTCTGGTCCATTTGGTC
CTCATCCTGAGGCTGCCCTTCTGTGGGCCTCATGAAGTCAATCACTTCTTCTGTGAAATC
CTGTCTGTCCTCAAGCTGGCCTGTGCTGACACAACACTCAATCAAGTTGTTATCTTTGCA
GCCTGTGTGTTTGCCTTAGTGGGGCCACTGTGCTTAGTGCTGGTCTCCTACACACGCATC
CTGGTGACTATCCTGAGGATCCAGTCAGGGGAGGGACGCAGAAAGGCCTTCTCTACCTGT
TCCTCCCACCTCTGTGTGGTAGGGCTCTTCTTTGGCAGTGCCATTGTCATGTACATAGCC
CCCAAGTCCCAGCACCCTGAAGAGCTGCAGAAGATCCTTTTCCTGTTTTACAGTTTTTTC
AACCCCATGCTGAACCCCCTGATCTACAGCCTGAGGAATGCTGAGGTCAAGGGTGCCCTT
AGGAGGTCACTGTGCAATGAAAACCATTCCCAATTGGTG


Conceptual translation

MKENQTMVTEFILLGFCLGPRIHVILFALFSVCYIFTLLGNGFTLGLICLEPRLHSPMYF
FLSNLATVDIAYACNTVPQTLVNLLDETKPISFAGCMMQTYLFLTFGSTECVLLVVMSYD
RYVAICHPLHYTVIMNWRVCTIMAAVSWIFSFLLALVHLVLILRLPFCGPHEVNHFFCEI
LSVLKLACADTTLNQVVIFAACVFALVGPLCLVLVSYTRILVTILRIQSGEGRRKAFSTC
SSHLCVVGLFFGSAIVMYIAPKSQHPEELQKILFLFYSFFNPMLNPLIYSLRNAEVKGAL
RRSLCNENHSQLV