Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

Back to all Rat symbols

Rat Or2a51 Olfactory Receptor

Gene Symbol Or2a51
Organism Rat
Family 2
Subfamily a
Pseudo No
Location chr4:72637035-72637973 (+)
Aliases Olr819

Sequence information


Nucleotide sequence

ATGGAAGAAAATCAGACCATGGTCACAGAGTTCATCCTGCTGGGATTCTGTCTTGGCCCG
AGGATTCACATAGCTCTTTTTGCATTGTTCTCTCTCTGCTACATCTTTACTTTGTTGGGG
AATGGGTTTACCCTTGGATTAATCTGCGTAGAGCCCAGGCTACATTCTCCTATGTACTTC
TTCCTCTCCAACCTGGCCACCGTTGATATTGCCTATGCTTGCAATACAGTGCCACAAACA
CTGGTAAACCTCTTGGATGAAACCAAGTCCATCTCCTTTGCTGGCTGCATGATGCAAACT
TATCTCTTTTTGACATTTGCAAACACAGAATGTGTCCTCCTTGTGGTGATGTCCTATGAT
AGATTTGTGGCCATCCGTCACCCCCTACACTACACTGTCATCATGAACTGGAAAGTATGT
ACCATCTTGGCTGCTGTTTCCTGGATAGTAAGCTTTCTCTTGGCTCTGGTTCATTTAGTC
CTCATTCTGAAGCTGCCCTTCTGTGGACCTCATGTAATCAATCACTTCTTCTGTGAAATC
CTGTCTGTCCTCAAGCTGGCCTGTGCTGACACAACACTCAATCAAGTCATCATCTTTGCA
GCCTGTGTATTTGCCTTAGTGGGGCCCCTATGCTTTGTACTAGTCTCCTATACATGCATC
CTGGTGGCCATCCTTAGGATCCAGTCAGGGGAGGGCCGCAGAAAGGCCTTCTCTACCTGT
TCTTCCCACCTCTGTGTGGTAGGGCTCTTCTTTGGCAGTGCCATTGTCATGTACATGGCA
CCCAAGTCCCAGCACCCAGAAGAGCAGCAGAAGATCCTTTTCTTGTTTTACAGTTTTTTC
AACCCCATGCTGAATCCCCTGATATACAGCCTGAGGAATGCTGAGGTCAAGAGTGCCCTT
AGGAGGTCGCTGTGCAACAAAAATCATTCCCAATTGGTG


Conceptual translation

MEENQTMVTEFILLGFCLGPRIHIALFALFSLCYIFTLLGNGFTLGLICVEPRLHSPMYF
FLSNLATVDIAYACNTVPQTLVNLLDETKSISFAGCMMQTYLFLTFANTECVLLVVMSYD
RFVAIRHPLHYTVIMNWKVCTILAAVSWIVSFLLALVHLVLILKLPFCGPHVINHFFCEI
LSVLKLACADTTLNQVIIFAACVFALVGPLCFVLVSYTCILVAILRIQSGEGRRKAFSTC
SSHLCVVGLFFGSAIVMYMAPKSQHPEEQQKILFLFYSFFNPMLNPLIYSLRNAEVKSAL
RRSLCNKNHSQLV