Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

Back to all Mouse symbols

Mouse Or2a57 Olfactory Receptor

Gene Symbol Or2a57
Organism Mouse
Family 2
Subfamily a
Pseudo No
Location chr6:43235610-43236572 (+)
Aliases Olfr47, IB12, MOR261-9

Sequence information


Nucleotide sequence

ATGGAGGAAAATCAGACCACAGTCACAGAGTTCATCCTGCTGGGATTCTGTCTTGGCCCG
AGGATTCACCTAGTTCTTTTTCTGCTTTTCTCTCTCTTCTATACTCTCACCATACTGGGG
AATGGGACTATCCTTGCAATGATCTGCCTGGACTCCAGACTCCACACTCCCATGTACTTC
TTCCTGTCCCACCTGGCCATTGTCGATATGGCCTATGCCTGCAACACAGTGCCACAGACA
CTCATAAACCTCTTGGATGAGACCAGGCCCATCACCTTTGCAGGATGCATGACACAGACT
TATCTATTTTTGACATTTGCTATCACCGAATGTCTTCTTCTTGTGGTGATGTCCTATGAT
CGATATGTTGCCATCTGCCACCCGCTACACTACACTGTCATCATGAACTGGAGAGTGTGT
ACCATCATGGCTGCTGTTTCCTGGATAGTCAGCTTTCTCCTGTCTCTGGTCCATTTACTT
CTCATCCTGAGGCTCCCCTTCTGTGGACCTCATGAAATCAATCACTTCTTCTGTGAAATC
CTGTCTGTCCTCAAGCTGGCCTGTGCTGACACAACACTCAATCAAGTTGTCATTTTTGCA
GCCTGTGTGTTCACTTTAGTGGGGCCCCTGTGCTTTGTACTAGTCTCCTACACACGCATC
CTGGTGGCAATCCTGAGGATTCAGTCAGGGGAGAGACGCAGAAAGGCCTTCTCCACCTGT
TCCTCCCACCTCTGTGTGGTAGGGCTCTTCTTTGGCAGTGCCATTGTCATGTACATGGCC
CCCAAGTCCCAGCACCCAGAGGAGCAGCAGAAGATCCTTTTCCTGTTTTACAGTTTTTTC
AACCCCATGCTGAACCCCCTGATCTACAGCCTGAGGAATGCTGAAGTCAAGGGTGCCCTC
CGGAGGGCACTGTGCAAAGAAAGTCATTCTTGTTTGGTGTGGTGTTCCCACCACAAGCCT
TGG


Conceptual translation

MEENQTTVTEFILLGFCLGPRIHLVLFLLFSLFYTLTILGNGTILAMICLDSRLHTPMYF
FLSHLAIVDMAYACNTVPQTLINLLDETRPITFAGCMTQTYLFLTFAITECLLLVVMSYD
RYVAICHPLHYTVIMNWRVCTIMAAVSWIVSFLLSLVHLLLILRLPFCGPHEINHFFCEI
LSVLKLACADTTLNQVVIFAACVFTLVGPLCFVLVSYTRILVAILRIQSGERRRKAFSTC
SSHLCVVGLFFGSAIVMYMAPKSQHPEEQQKILFLFYSFFNPMLNPLIYSLRNAEVKGAL
RRALCKESHSCLVWCSHHKPW