Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

Back to all Rat symbols

Rat Or2a57 Olfactory Receptor

Gene Symbol Or2a57
Organism Rat
Family 2
Subfamily a
Pseudo No
Location chr4:72670543-72671502 (+)
Aliases Olr821

Sequence information


Nucleotide sequence

ATGAAAGAAAATCAGACTGTGGTCACAGAGTTCATCCTGCTGGGATTCTGTCTTGGCCCA
AGGATTCACCTAGTTCTTTTTCTACTTTTCTCTCTCTTCTATATGTTCACCATACTGGGC
AATGGGACTATCCTTGCAATGATCTGCCTGGACTCCAGACTCCACACTCCCATGTACTTC
TTCCTGTCCCACCTGGCCATTGTCGATATGGCCTATGCCTGCAACACAGTGCCACAAACA
CTGGTAAACCTCTTGGATGAGACCAAGCCCATCTCCTTCACTGGATGCATGACACAGACT
TATCTATTTTTGACATTTGCTATCACCGAATGTCTTCTCCTTGTGGTGATGTCCTATGAT
CGGTATGTTGCTATCTGCCACCCGCTACACTACTCTGTCATCATGAACTGGAGAGCGTGT
AGTATCCTGGCTGCTGTTTCCTGGATAGTTAGCTTTCTCCTTTCTTTGGTCCACTTACTT
CTTATCCTAAGGCTGCCCTTCTGTGGACCTCATGAAATCAATCACTTCTTCTGTGAAATC
CTGTCTGTCCTCAAGCTGGCCTGTGCTGACACAACACTCAATCAACTTGTCATCTTTACA
GCCTGTGTGTTCACCTTAGTGGGGCCCCTGTGCTTTGTTCTAGTCTCCTATATGCGCATC
CTGGTGGCCATCCTTAGGATCCAGTCAGGGGAGGGCCGCAGAAAGGCCTTCTCCACCTGT
TCCTCCCACCTCTGTGTGGTAGGGCTCTTCTTTGGCAGTGCCATTGTCATGTACATGGCC
CCCAAGTCAGAGCACCCTGAGGAACAGCAGAAGATCCTTTTCTTGTTTTACAGTTTTTTC
AACCCCATGCTGAACCCCCTGATCTACAGCCTGAGGAATGCTGAGGTCAAAGGTGCCCTC
TGGAGGGTACTGTGCAAAGAAAGTCATTCTTGTTTGGTGTGGTGTTCACACCACAAGGCT


Conceptual translation

MKENQTVVTEFILLGFCLGPRIHLVLFLLFSLFYMFTILGNGTILAMICLDSRLHTPMYF
FLSHLAIVDMAYACNTVPQTLVNLLDETKPISFTGCMTQTYLFLTFAITECLLLVVMSYD
RYVAICHPLHYSVIMNWRACSILAAVSWIVSFLLSLVHLLLILRLPFCGPHEINHFFCEI
LSVLKLACADTTLNQLVIFTACVFTLVGPLCFVLVSYMRILVAILRIQSGEGRRKAFSTC
SSHLCVVGLFFGSAIVMYMAPKSEHPEEQQKILFLFYSFFNPMLNPLIYSLRNAEVKGAL
WRVLCKESHSCLVWCSHHKA