Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

Back to all Rat symbols

Rat Or2a7-ps Olfactory Receptor

Gene Symbol Or2a7-ps
Organism Rat
Family 2
Subfamily a
Pseudo Yes
Location chr4:72603494-72604171 (+)
Aliases Olr818

Sequence information


Nucleotide sequence

TTAGATCCAGTGAAGCCAATTTCCTATGCTGGTTGTATGACACAGACTTTTCTCTTTTTG
ACATTTGCTATCACAGAATGCCTTCTCCTGGTGGTAATGTCCTATGACCGGTATGTTGCA
ATCTGCCACCCACTCCGATACTCTGTCATCATGAGCTGGAGAGTGTGCAGCACCATGGCA
GTGACTTCCTGGATTATTGGTTTTCTCCTGGCCTTGATTCATCTGGTGTTACTTTTACCT
TTACCTTTCTGTGTGTCTCAGAAAGTGAACCATTTTTTCTGTGAAATTACAGCTATCCTC
AAACTTGCCTGTGCAGACACACACCTCAATGAAACTATGGTCCTGGCTGGGGCAGTGTCT
GTCCTTCTGGGACCATTCTCCTCAATTGTGGTCTCTTATGCATGTATCCTTGGTGCTATA
CTGAGGATCCAGTCAGGGGAGGGGCAAAGGAAAGCCTTTTCCACCTGCTCCTCCCACCTC
TGTGTGGTCGGATTGTTTTATGGTACCGCCATTGTCATGTACGTTGGACCCAGACATGGG
AGCCCTAAGGAACAGAAGAAATATCTCTTGCTGTTTCACAGCCTTTTTAACCCCATGCTC
AACCCTTTAATCTATAGTCTCAGGAATTCTGATGTGAAGAATACTTTGAAAAGAGTGCTG
GGGACACAGAGAGCTTTG


Conceptual translation

LDPVKPISYAGCMTQTFLFLTFAITECLLLVVMSYDRYVAICHPLRYSVIMSWRVCSTMA
VTSWIIGFLLALIHLVLLLPLPFCVSQKVNHFFCEITAILKLACADTHLNETMVLAGAVS
VLLGPFSSIVVSYACILGAILRIQSGEGQRKAFSTCSSHLCVVGLFYGTAIVMYVGPRHG
SPKEQKKYLLLFHSLFNPMLNPLIYSLRNSDVKNTLKRVLGTQRAL