Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

Back to all Rat symbols

Rat Or2ab1 Olfactory Receptor

Gene Symbol Or2ab1
Organism Rat
Family 2
Subfamily ab
Pseudo No
Location chr10:44228800-44229744 (+)
Aliases Olr1431

Sequence information


Nucleotide sequence

ATGAGACCCCAGAATTCTAGCACCATCACTGAGCTGATCCTTGTTGGGTTTTCTGATCAC
CCTGAGACTGAGGTTCCCCTCTTCCTCATCTTCTCTCTGGTCTACCTAGCCAACTGTTTG
GGGAACACAGCTGTTGTCACATTAGTGGCTCTAGATGTCTCTCTGCAGACACCCATGTAT
TTCTTCCTCTGTCACCTGGCTTTCCTCAATGGCTTCTTCAGCACGGTTGTGGCACCAAAG
ATGCTCTTCAATTTTCTTGCAAGCAGGAAGGTCATATCTTACCCATTCTGCCTGGCTCAG
ACCTACCTCACCCTGTTCTTGGAGTCGACTGAGTGCTTTCTTCTTGCAGTGATGGCCATA
GATCGCTATGTGGCAATCTGCTACCCACTGAGGTACCTTCTCATCATGAGCTGGGTGGTG
TGCACAGCACTGTCCGTGGCAATCTGGGTCATAGGCTTTTGTGCCTCCGTTATACCTCTC
TGCTTCACGATCCTCCCACTCTGTGGTCCTTACGTCGTTGATTATCTTTTCTGCGAGCTG
CCCATCCTTCTGCACCTGTTCTGCACAGATACATCTCTGCTGGAGGCCATGATGGCCATT
GGAGGGGCCGGCACTGTGCTGTTCCCCTTCCTCCTGATTGTTCTCTCCTACCTTCGCATC
CTGGTGGCTGTGATAAGAATAGACTCAGCTGAGGGCAGAAAAAAGGCCTTTTCAACTTGT
GCTTCACACTTGGCTGTGGTGACCATCTACTATGGAACAGGGCTGATCAGGTACTTGAGG
CCCAAGTCCCTTTATTCCGCTGAGGGAGACAAACTGATCTCTGTGTTCTATGCAGTCATT
GGCCCTGCACTGAACCCATTCATCTACAGCCTGAGGAACAAGGAAGTGCAGGGTGCCATG
AGGAGAGTGATGGAGAGATACAAGAAAAGCACAAGAGTCACCTTC


Conceptual translation

MRPQNSSTITELILVGFSDHPETEVPLFLIFSLVYLANCLGNTAVVTLVALDVSLQTPMY
FFLCHLAFLNGFFSTVVAPKMLFNFLASRKVISYPFCLAQTYLTLFLESTECFLLAVMAI
DRYVAICYPLRYLLIMSWVVCTALSVAIWVIGFCASVIPLCFTILPLCGPYVVDYLFCEL
PILLHLFCTDTSLLEAMMAIGGAGTVLFPFLLIVLSYLRILVAVIRIDSAEGRKKAFSTC
ASHLAVVTIYYGTGLIRYLRPKSLYSAEGDKLISVFYAVIGPALNPFIYSLRNKEVQGAM
RRVMERYKKSTRVTF