Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

Back to all Mouse symbols

Mouse Or2ac1-ps Olfactory Receptor

Gene Symbol Or2ac1-ps
Organism Mouse
Family 2
Subfamily ac
Pseudo Yes
Location chr6:43187071-43187437 (+)
Aliases Olfr436-ps1

Sequence information


Nucleotide sequence

ACTCAATCTCGAGTTAGTTGGGCTATAAATATTTGCATACCCATTCTAAGTCTGCTCTTC
TGGGTAACAAATGGAACCAATCAATTCTTTTGTGAAACCCTGTCTGTCCTCAAGCTGGAA
TCAACAAAGCCATCATCTACACTGCTTCTGTGCTCATCTTAGTGGGGCCTCTGCACTTGG
TGCTAGTCTCCAACAGGTACATCCTGGTGTCTGTTCTCAGGATGAAGTCATAGGAGGGTC
TCAGAAAAGCCTTCTCTGCCTGTTCTTCCCACCACTATGTGGTTGGGCTCTTCTTTGTCA
GTATCATCATTATGTACATGACCCCAAGTCCCAGAACCCTGAAGAGCAACAGAAGTGTAT
TTTCTTT


Conceptual translation

TQSRVSWAINICIPILSLLFWVTNGTNQFFCETLSVLKLE/NKAIIYTASVLILVGPLH
LVLVSNRYILVSVLRMKS*EGLRKAFSACSSHHYVVGLFFVSIIIMYMTPS/QNPEEQQ
KCIFF