Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

Back to all Mouse symbols

Mouse Or2ag12 Olfactory Receptor

Gene Symbol Or2ag12
Organism Mouse
Family 2
Subfamily ag
Pseudo No
Location chr7:106677537-106678484 (-)
Aliases Olfr693, MOR283-8

Sequence information


Nucleotide sequence

ATGGAGCCCTGGAACTCCACCTTGGGAAGTGGCTTCATCTTGGTGGGGATTCTGGATGGC
AGTGGCTCTCCTGAACTGCTCTGTGCTACAATTGCTGCCCTGTACATGTTGGCACTGATC
AGCAATGGAATGCTGATCCTGGTCATCACAATGGATATTTACCTCCATGTTCCCATGTAC
CTCTTGCTTGAGCAGCTATCTCTCATGGACCTTCTTCTCGCCTCAGTTATCAGTCCCAAA
GCTGTCATGGACTTTCTGCTCAAAGACAACACCATCACCTTTGGTGGTTGTGCCCTTCAG
ATGTTCTTGGAACTGGCACTGGGTAGTGCAGAGGACCTCCTTCTGGCCTTCATGGCTTAT
GACAGGTATGTGGCCATTTGTCATCCATTGAACTACATGATATTCATGAGGCCAAGCATC
TGCTGGCTTATGGTGGCCATCTCCTGGATTCCAGCTTCTCTGAGTGCCCTGGGATATACC
ATCTACACTATGCAGTACCCCTTCTGCAAATCCCGGGAGATTAGACACCTTTTCTGTGAG
ATCCCCCCATTGCTGAAGCTGGCCTGTGCAGACACCTCCAGATATCAACTCATGGTTTAT
TTGATGGGTGTGACCTTGCTCATCCCTCCTCTTGCTGCCATACTGGCCTCCTACTCACTA
ATTCTGTTCACTGTGCTCAAAATGCCCTCAAACGAGGGAAGAAAGAAAGCCCTTGTTACC
TGCTCTTCCCACCTGACTGTAGTTGGGATGTACTATGGGCCTCTCACAGTCATGTACATC
CTGCCTAGTTCCTACCACAGTTCCAAACAAGAAAATATCCTCTCTTTTTTGTACACAATT
GTAACGCCAGCTCTGAATCCTTTAATCTACAGTTTAAGAAATAAAGAGGTCAGTGGGGCT
TTGAAGAGAGTCCTAGGAAAACGGTTGTTGTCAACACACCCTAACTTC


Conceptual translation

MEPWNSTLGSGFILVGILDGSGSPELLCATIAALYMLALISNGMLILVITMDIYLHVPMY
LLLEQLSLMDLLLASVISPKAVMDFLLKDNTITFGGCALQMFLELALGSAEDLLLAFMAY
DRYVAICHPLNYMIFMRPSICWLMVAISWIPASLSALGYTIYTMQYPFCKSREIRHLFCE
IPPLLKLACADTSRYQLMVYLMGVTLLIPPLAAILASYSLILFTVLKMPSNEGRKKALVT
CSSHLTVVGMYYGPLTVMYILPSSYHSSKQENILSFLYTIVTPALNPLIYSLRNKEVSGA
LKRVLGKRLLSTHPNF