Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

Back to all Mouse symbols

Mouse Or2ag13 Olfactory Receptor

Gene Symbol Or2ag13
Organism Mouse
Family 2
Subfamily ag
Pseudo No
Location chr7:106713735-106714679 (-)
Aliases Olfr695, MGC123710, MGC123711, MOR283-6

Sequence information


Nucleotide sequence

ATGGAAGTCTTCAACTCCACCTTGGGAAGTGGCTTCATCTTGGTAGGAATTCTGAATGAC
AGTGGTTTTCCAGAAATGCTCTGTGCCATTATCATAGCACTATACTTTTTAGCCTTGACC
AGCAATGGACTGCTGCTGCTGGTCATCACCATGGATGCCCGACTCCACATGCCCATGTAT
CTTCTGCTCTGGCAACTCTCTCTCATGGACCTCCTCCAACCATCAGTTATCATTCCCAAG
GCCGTACTAGATTTTCTTCTCAAAGATAACACTATCTCATTTGGGGGATGTGCCTTTCAG
ATGTTTCTGGCACTGACACTTGGTAGTGCAGAGGACCTCCTTCTGTCCTTTATGGCTTAT
GACAGGTATGTGGCCATTTGTCATCCTCTGAACTATACAATCCTAATGAGTCAGAAAGTC
TGCTATCTCATGATAGCCACCTCATGGATTCTTGCATCTCTCAGTGCTCTAGGATATAGC
ATGTATACCATGCAGTATCCTTTCTGCAAGTCCAGGCAGATCAGACATCTCTTCTGTGAG
ATTCCACCCTTGCTGAAGCTGGCCTGTGGTGACACCTCCACATATGAACTCATGGTTTAT
TTGATGGGTGTGACTTTGCTCTTTCCTGCTCTTGCGGCCATCCTGACCTCCTACTCACTA
ATTCTGCTTACTGTGCTCCATATGCCCTCAAATGAGGGCAGGAAAAAAGCCCTTGTCACC
TGCTCTTCCCATCTGACTGTGGTTGGCATGTGGTATGGGGGTGCTATTTTCATGTATATC
CTGCCTAGTTCCTTCCACAGCCCCAAACAAGACAATATCAGCTCAGTTTTCTACATGATT
GTCACTCCAGCTCTGAATCCCCTCATCTACAGCCTGAGGAATAATGAGGTTATTGAGGCT
TTGAAAAGAGTCCTGGGAAAAAAGTTTTCAGTGCATTCCACATTC


Conceptual translation

MEVFNSTLGSGFILVGILNDSGFPEMLCAIIIALYFLALTSNGLLLLVITMDARLHMPMY
LLLWQLSLMDLLQPSVIIPKAVLDFLLKDNTISFGGCAFQMFLALTLGSAEDLLLSFMAY
DRYVAICHPLNYTILMSQKVCYLMIATSWILASLSALGYSMYTMQYPFCKSRQIRHLFCE
IPPLLKLACGDTSTYELMVYLMGVTLLFPALAAILTSYSLILLTVLHMPSNEGRKKALVT
CSSHLTVVGMWYGGAIFMYILPSSFHSPKQDNISSVFYMIVTPALNPLIYSLRNNEVIEA
LKRVLGKKFSVHSTF