Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

Back to all Rat symbols

Rat Or2ag13 Olfactory Receptor

Gene Symbol Or2ag13
Organism Rat
Family 2
Subfamily ag
Pseudo No
Location chr1:173179801-173180826 (-)
Aliases Olr203

Sequence information


Nucleotide sequence

ATGACCATTGGCAAATTGAATTCATATCAGCAAAACGTCACCAAGCGTATGTTTTGTAGG
CAACTAAAAAGACCACACAGAATGGAAGTCTGCAACTCCACCTTGGGAAGTGGCTTCATC
TTAGTGGGGGTTCTAGATGACAGTAGTTTTCCAGAACTGCTCTGTGCCACTATCACAGCC
CTGTACTTTTTAGCATTGACCAGCAATGGACTTCTGCTGATGGTCATCACCATGGATGCC
CGGCTACATGTGCCCATGTATCTACTACTCTGGCAGCTCTCCCTCATGGACCTCCTCCAA
CCATCAGTTATCATTCCCAAGGCCATAATAGATTTTCTTCTCAAAGACAACACTATTTCA
TTTGGGGGGTGTGCCCTTCAGATGTTCCTGGCACTGACACTTGGTAGTGCAGAGGACCTC
CTTCTGTCCTTTATGGCCTATGACAGGTATGTAGCCATTTGCCATCCTCTGAACTACAGA
ATCCTAATGAGTCAGAAAGTCTGCTGGGTCATGATAGCCACCTCATGGATCCTGGCATCC
CTCAGTGCTCTAGGCTATAGCATGTATACCATGCGATATCCTTTCTGTAAATCCAGGCAG
ATCAGACACCTCTTTTGTGAGATTCCTCCCTTGCTGAAGCTGGCCTGTGGAGACACCTCC
ACATATGAACTCATGGTTTATTTGATGGGTGTGACTTTACTCTTTCCTGCCCTTGCTGCC
ATCCTGACCTCTTACTTACTAATTCTGCTCACTGTGCTCCACATGCCCTCTAATGAGGGC
AGGAAGAAAGCCCTTGTCACCTGCTCTTCCCATCTCACTGTGGTAGGGATGTGGTATGGG
GGTGCTATTTTCATGTATATCCTGCCCAGTTCCTTCCACAGCCCAAAGCAGGACAATATC
AGCTCAGTGTTCTACATGATTGTTACTCCAGCTCTGAATCCTCTCATCTACAGCCTGAGG
AATAATGAGGTCACTGAAGCATTGAGACGAGTCCTGGGGAAAAGATTGCCAGTAAAGTCT
ACATTC


Conceptual translation

MTIGKLNSYQQNVTKRMFCRQLKRPHRMEVCNSTLGSGFILVGVLDDSSFPELLCATITA
LYFLALTSNGLLLMVITMDARLHVPMYLLLWQLSLMDLLQPSVIIPKAIIDFLLKDNTIS
FGGCALQMFLALTLGSAEDLLLSFMAYDRYVAICHPLNYRILMSQKVCWVMIATSWILAS
LSALGYSMYTMRYPFCKSRQIRHLFCEIPPLLKLACGDTSTYELMVYLMGVTLLFPALAA
ILTSYLLILLTVLHMPSNEGRKKALVTCSSHLTVVGMWYGGAIFMYILPSSFHSPKQDNI
SSVFYMIVTPALNPLIYSLRNNEVTEALRRVLGKRLPVKSTF