Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

Back to all Mouse symbols

Mouse Or2ag15 Olfactory Receptor

Gene Symbol Or2ag15
Organism Mouse
Family 2
Subfamily ag
Pseudo No
Location chr7:106740985-106741932 (-)
Aliases Olfr697, MOR283-5

Sequence information


Nucleotide sequence

ATGGAGTTCAGGAATTCAACTTTAGGAAGTGGCTTCATCTTGGTAGGAATCCTGAATGGC
AGTGACTCTCCTGAACTACTCTGTGCCACAATTACATTCCTGTACACACTGGCACTGACC
AGCAATGGACTGCTGCTCCTTGTCATCACAGTAGATACCCGGCTCCACGTGCCCATGTAC
CTTCTACTTGGGCAGCTCTCTCTCATTGATCTCCTCCTGACATCAGTCATTACTCCCAAA
GCTGTCATGGATTTTCTTCTGAGAGACAACACTATCTCCTTTGGAGGCTGTGCCCTTCAG
ATGTTCATTGAATTGGTACTGGGTGGTGCAGAGGACCTTCTTCTGGCTTTTATGGCCTAT
GACAGGTATGTGGCCATTTGTCATCCTCTGAACTACATGATCCTCATGAGTCCAAGAGTC
TGCTGGCTCATGGTGACTGCATCATGGATCCTGTCAATCCAGATGGCCCTGGGATTTACC
ATCAACACAATGCATTATTCTTTCTGCAAATCGAGGCATATCAGACACCTCTTCTGTGAG
ATCCCTCCCTTGCTGGATTTGGCCTGTGCAGACACCTCTAGTTATAAGCTTGTGGTTTAT
TTGGTAGGTGTGTTCATGTTAATTCTCCCTCTTACTGCCATCTTTTTCTCTTATGCACGG
ATTTTGTTCACTGTTCTCCACATGCCTTCAAATGAGAGCAGGAAGAAAGCCCTTGTTACC
TGTTCTTCCCATATGACTGTTGTAGGCATGTACTATGGGGCTCTCACAGTCATGTATTTC
CTACCAAGTTCCTACCACAATCCCAAGCAAGACAATATCCTTTCTGTTTTCTACACAATT
GTCACCCCAGCTCTAAACCCACTCATCCACAGCCTGAGGAATAAGGAAGTGACTGGGGCT
CTGAGGAAAGTCCTGGGAAATACTTGTTGCCACCACCCCATACATTTA


Conceptual translation

MEFRNSTLGSGFILVGILNGSDSPELLCATITFLYTLALTSNGLLLLVITVDTRLHVPMY
LLLGQLSLIDLLLTSVITPKAVMDFLLRDNTISFGGCALQMFIELVLGGAEDLLLAFMAY
DRYVAICHPLNYMILMSPRVCWLMVTASWILSIQMALGFTINTMHYSFCKSRHIRHLFCE
IPPLLDLACADTSSYKLVVYLVGVFMLILPLTAIFFSYARILFTVLHMPSNESRKKALVT
CSSHMTVVGMYYGALTVMYFLPSSYHNPKQDNILSVFYTIVTPALNPLIHSLRNKEVTGA
LRKVLGNTCCHHPIHL