Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

Back to all Mouse symbols

Mouse Or2ag16 Olfactory Receptor

Gene Symbol Or2ag16
Organism Mouse
Family 2
Subfamily ag
Pseudo No
Location chr7:106752454-106753386 (-)
Aliases Olfr698, MOR283-3

Sequence information


Nucleotide sequence

ATGGAGCTCTGGAACTCGACTGTGGGAAGTGGTTTCATCTTGGTGGGGATTCTGGATGGC
AGTGGCTCTCCTGAACTGCTCTGTGCTGCAATTACAGCCCTGTACTTCTTAGCCCTGACC
AGCAATGGGCTGCTGCTTCTAGTCATCACCATGGATGCCCGGCTCCATGTGCCCATGTAT
CTTCTACTTGGACAGCTTTCTCTCATGGACCTCCTCCTCACATCAGTTATCACTCCCAAG
GCTGTTGTGGATTTTCTCCTCAAAGACAATACCATATCCTTTGGAGGTTGTGCCCTTCAG
ATGTTTCTAGAGCTGGCACTGGGTAGTGCAGAGGACCTTCTTCTGGCCTTTATGGCCTAT
GACAGGTATGTAGCCATTTGTCAACCTCTGAACTACACAATCTTAATGAGTCACAAAGTC
TGCTGGCTCATGATAGCCACCTCATGGATCTTGGCATCCCTCAGTGCTCTAGGATATAGC
ATCTACACCATGCAGTATTCCTTCTGCAAAAATCGTCAGATCAATCATCTGTTCTGTGAG
ATCCCCCCATTGCTGAAGCTGGCCTGTGCAGACACCTCCACATATGAACTCATGGTTTAT
TTGATGGGGGTTATTGTGCTAATTCTTCCTCTTACTGCCATCCTGGCCTCCTACTCACTA
ATTCTGTTCACTGTGCTCAATATGCCCTCAAATGAGGGCAGGAAGAAAGCCCTTGTCACC
TGCTCTTCCCATCTGACTGTAGTTGGGATGTGGTATGGGGGTGCTTCCTTCATGTATGTT
CTACCCAGTCCCTTTCACAGCCCCAAACAAGACAATATCAGCTCAGTTTTCTACACGATT
GTCACTCCGGCTCTGAATCCCCTTATCTACAGCCTGAGGAATAAAGAGGTCACTGGAGCT
TTGAAGAGAGTCCTGGGAAAACGATTGTCAGCA


Conceptual translation

MELWNSTVGSGFILVGILDGSGSPELLCAAITALYFLALTSNGLLLLVITMDARLHVPMY
LLLGQLSLMDLLLTSVITPKAVVDFLLKDNTISFGGCALQMFLELALGSAEDLLLAFMAY
DRYVAICQPLNYTILMSHKVCWLMIATSWILASLSALGYSIYTMQYSFCKNRQINHLFCE
IPPLLKLACADTSTYELMVYLMGVIVLILPLTAILASYSLILFTVLNMPSNEGRKKALVT
CSSHLTVVGMWYGGASFMYVLPSPFHSPKQDNISSVFYTIVTPALNPLIYSLRNKEVTGA
LKRVLGKRLSA