Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

Back to all Rat symbols

Rat Or2ag16b Olfactory Receptor

Gene Symbol Or2ag16b
Organism Rat
Family 2
Subfamily ag
Pseudo No
Location chr2:4800365-4801309 (+)
Aliases Olr206

Sequence information


Nucleotide sequence

ATGGAGCTCTGGAACTCGACCTTGGGAAGTGGCTTCATCTTGGTGGGGATTCTAGATGGC
AGTGGCTCTCCTGAACTGCTCTGTGCCACAATCACAGCCTTGTACTTCTTAGCCCTAACC
AGCAATGGACTACTGCTGCTTGTCATTACCATGGATGCCCGGCTCCACGTGCCCATGTAT
CTTCTACTTGGACAGCTGTCTCTCATGGACCTACTTCTCACTTCAGTTATCACTCCCAAG
GCTGTTGTAGACTTTCTCCTCAAAGACAACACCATATCCTTTGGAGGTTGTGCCCTTCAG
ATGTTTCTAGAACTGGCACTAGGTACTGCAGAGGACCTTCTTCTAGCCTTTATGGCCTAT
GATAGGTATGTAGCTATTTGTCAACCTCTAAACTACACAATCTTAATGAGTCACAAAGTC
TGCTGGCTCATGATAGCTACCTCATGGATCCTGGCATCCCTCAGTGCTCTAGGATATAGC
ATCTACACCATGCAGTATTCCTTCTGCAAATCTCGTATGGTCAATCACCTGTTCTGTGAG
ATACCCCCATTGCTGAAGCTGGCCTGTGCAGACACATCCAGATATGAACTTATGGTTTAT
TTGATGGGTGTGATTGCACTACTTCTTCCTCTTGCTGCCATCCTGGCCTCCTACTCACTA
ATTCTGTTCACTGTGCTCCACATGCCCTCAAATGAGAGCAGGAAAAAAGCCCTTGTCACC
TGCTCTTCCCACCTGACTGTGGTTGGGATGTGGTATGGTGGTGCTTCCTTCATGTATGTC
CTACCCAGTCCCTTCCACACCGCCAAACAAGACAATATCAGCTCAGTTTTCTACACGATT
GTTACTCCAGCTCTGAATCCCCTCATCTACAGCCTGAGGAATAAGGAGGTCACTGGAGCT
TTGAAGAGAGTCCTGAGGAAACGATTGTCAACACAGCCTAACCTC


Conceptual translation

MELWNSTLGSGFILVGILDGSGSPELLCATITALYFLALTSNGLLLLVITMDARLHVPMY
LLLGQLSLMDLLLTSVITPKAVVDFLLKDNTISFGGCALQMFLELALGTAEDLLLAFMAY
DRYVAICQPLNYTILMSHKVCWLMIATSWILASLSALGYSIYTMQYSFCKSRMVNHLFCE
IPPLLKLACADTSRYELMVYLMGVIALLLPLAAILASYSLILFTVLHMPSNESRKKALVT
CSSHLTVVGMWYGGASFMYVLPSPFHTAKQDNISSVFYTIVTPALNPLIYSLRNKEVTGA
LKRVLRKRLSTQPNL