Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

Back to all Rat symbols

Rat Or2ag18 Olfactory Receptor

Gene Symbol Or2ag18
Organism Rat
Family 2
Subfamily ag
Pseudo No
Location chr1:170742785-170743732 (-)
Aliases Olr208

Sequence information


Nucleotide sequence

ATGGAGCTTTGGAATTCTACCTTGGGAAGTGGCTTCATCTTGGTTGGGATTCTGGATGAC
AGTGGCTCCCCTGAACTGCTCTGTGCCACATTCACAGCCCTGTACATGTTGGCTATGATC
AGCAATGGCCTACTCCTCCTGGTCATCACCATGGATCCCCAGCTCCATGTGCCCATGTAT
CTTCTGCTCTGGCAGCTCTCTCTTATGGATCTCCTCCTCACATCAGTTATCACTCCCAAG
GCAGTTATTGATTTCCTGCTTAAAGACAACACCATCTCATTTGGAGGCTGTGCCCTTCAG
ATGTTCCTGGAACTGACACTGGGTGGTGCAGAAGACCTTCTTCTGGCCTTCATGGCCTAT
GATAGGTATGTGGCCATTTGTCACCCTCTGAACTACATGATCTTCATGAAGCCTAGGATC
TGCTGGCTTGGGGTGTTCATATCATGGGCCTTGGCATCTCTGAGTGCAGTAGGATATACC
ATCTACACCATGCAATACCCTTTCTGCAAATCGAGGAAGATCAAACACCTGTTCTGTGAG
ATCCCTCCATTGCTGAAGCTGGCCTGTGCAGACACCTCCACATATGAGCTCATGGTTTAT
GTGATGGGTGTGATCTTCCTACTTCTCCCTCTTGCTGCCATTCTTTCTTCTTATACACTA
ATTCTTCTCACTGTGCTCCACATGAATTCACATGAAGGCAGAAAGAAAGCTCTTGTCACT
TGCTCCTCACACCTAACTGTGGTTGGAATGTGGTATGGGGGAGCTTCTTTCATGTATGTC
CTACCCAGTTCCTTTCACACCCCCAAACAAGACAATATCTTCTCTGTTTTCTACACAATT
GTCACCCCAGCTCTGAACCCACTCATCTACAGCCTGAGGAATAGGGAGGTGACTGGGGCT
TTGAAGAGACTCCTGGGAGGACGCCTATTGCCAGAACACTGTACATTC


Conceptual translation

MELWNSTLGSGFILVGILDDSGSPELLCATFTALYMLAMISNGLLLLVITMDPQLHVPMY
LLLWQLSLMDLLLTSVITPKAVIDFLLKDNTISFGGCALQMFLELTLGGAEDLLLAFMAY
DRYVAICHPLNYMIFMKPRICWLGVFISWALASLSAVGYTIYTMQYPFCKSRKIKHLFCE
IPPLLKLACADTSTYELMVYVMGVIFLLLPLAAILSSYTLILLTVLHMNSHEGRKKALVT
CSSHLTVVGMWYGGASFMYVLPSSFHTPKQDNIFSVFYTIVTPALNPLIYSLRNREVTGA
LKRLLGGRLLPEHCTF