Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

Back to all Rat symbols

Rat Or2ag19b Olfactory Receptor

Gene Symbol Or2ag19b
Organism Rat
Family 2
Subfamily ag
Pseudo No
Location chr2:4820016-4820963 (+)
Aliases Olr205

Sequence information


Nucleotide sequence

ATGGAGTTTAGAAATTCGACATTGGGCAGTGGTTTCATCTTGGTGGGGATTCTGGATGAC
AGTGGCTCTCCTGAACTGCTCTGTGCCACAGTCACAGCCCTGTACATGTTGGCCATAACC
AGCAATGGAGTGCTACTCCTGGTCATCACTATGGATGCCCGGCTCCACGTGCCCATGTAT
CTCCTACTTGGACAGCTATCTTTCATAGACCTACTCCTAACATCAGTTATTACTCCCAAG
GCTGTCATGGATTTTCTGCTCAAAGACAACACCATCTCCTTTGAAGGTTGTGCCTTTCAG
ATGTTTCTAGAACTGGCACTGGGTAGTGCAGAGGACCTCCTTCTGGCCTTTATGGCCTAT
GACAGGTATGTGGCCATTTGTCATCCTCTAAATTACATGATCTTCATGAGGCCAAGTGTC
TGCTGGTTCATAGTAGGTACTACATGGTTCCTGGCATCTGTGATAGCCCTAGTATTTACT
ATCTACACCATGCACTATCCCTTCTGTCAATCCAGACAGATCAAACACCTGTTCTGCGAG
ATCCCTCCATTGCTGAAGCTGGCCTGTGCAGACACATCCACATATGAGCTGGTGGTTTAT
TTGACTAGTGTTTCTGTGTTGATTCTTCCTGTTGCTGTTATCATGGCATCCTATGTACGA
ATTCTGCTTACTGTATTCTACATGCCCTCAAATGAGGGCAGGAAGAAAGCCCTTGTCACC
TGTTCTTCTCATCTGATTGTGGTTGGGATGTGGTATGGGGGTTCTTCACTCATGTATGTC
CTTCCCAGTCAATTCCACAGCCCCAAACAAGACAATATCCTCTCCATTTTCTATACTGTT
GTCACTCCAGCTCTGAATCCTCTCATCTACAGCCTGAGGAATAAGGAAGTCACTGGGGCT
TTAAGGAGAATTCTTAGAAGACAGTTGTTGCCAATACAAACCACTTTC


Conceptual translation

MEFRNSTLGSGFILVGILDDSGSPELLCATVTALYMLAITSNGVLLLVITMDARLHVPMY
LLLGQLSFIDLLLTSVITPKAVMDFLLKDNTISFEGCAFQMFLELALGSAEDLLLAFMAY
DRYVAICHPLNYMIFMRPSVCWFIVGTTWFLASVIALVFTIYTMHYPFCQSRQIKHLFCE
IPPLLKLACADTSTYELVVYLTSVSVLILPVAVIMASYVRILLTVFYMPSNEGRKKALVT
CSSHLIVVGMWYGGSSLMYVLPSQFHSPKQDNILSIFYTVVTPALNPLIYSLRNKEVTGA
LRRILRRQLLPIQTTF