Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

Back to all Mouse symbols

Mouse Or2ag1b Olfactory Receptor

Gene Symbol Or2ag1b
Organism Mouse
Family 2
Subfamily ag
Pseudo No
Location chr7:106688788-106689729 (-)
Aliases Olfr694, MOR283-9

Sequence information


Nucleotide sequence

ATGGAAGTCTGCAACTCCACCCTGGGAAGTGGATTCATCTTGGTGGGGATTCTGGATGAC
AGTGGTTTTCCAGAGCTGCTCTGTGCCACTATCACAGCCCTGTACTTTTTAGCCATAACC
AGCAATGGACTGCTGCTTCTGGTCATCACCATGGATGCCCGGCTCCATGTTACCATGTAT
CTTCTGCTATGGCAGCTCTCTCTCATGGACTTGCTTCTCACATCAGTCATCACTCCAAAG
GCCATACTAGATTATCTTCTCAAAGATAACACTATCTCATTTGGGGGATGTGCCCTTCAG
ATGTTTCTGGAACTGACACTTGGTAGTGCAGAGGACCTCCTTCTGGCCTTCATGGCCTAT
GACAGGTATGTGGCCATTTGTCATCCTCTGAACTATACAATCCTAATGAGTCAGAAAGTC
TGCTGTCTCATGATAGCCACCTCATGGATCCTTGCATCTCTCAGTGCTCTAGGATATAGC
ATCTACACCATGCAATATCCTTTCTGCAAGTCCAGGCAGATCAGACACCTCTTCTGTGAG
ATTCCTCCCTTGCTAAAGCTGGCCTGTGCAGACACCTCCACATATGAACTCATGGTTTAT
GTGATGGGTGTGACCTTGCTCATCCCCCCTCTTGCTGCCATCCTGGCCTCCTACTCACTA
ATTCTATTCACTGTGCTGCACATGCCCTCAAATGAGGGCAGGAAAAAAGCCCTTGTCACC
TGCTCTTCCCATCTGACTGTGGTTGGGATGTGGTATGGGGGTGCTATTGTCATGTATGTA
TTACCCAGTTCCTTCCACAGCCCCAAACAAGACAATATCAGCTCAGTTTTTTATACAATT
TTCACTCCGGCTTTGAATCCCCTCATCTACAGCCTAAGGAATAAGGAGGTCACTGGGGCT
TTGAGGCGAGTCCTGGGGAAAAGGTTCTCAGTACAGTCTACA


Conceptual translation

MEVCNSTLGSGFILVGILDDSGFPELLCATITALYFLAITSNGLLLLVITMDARLHVTMY
LLLWQLSLMDLLLTSVITPKAILDYLLKDNTISFGGCALQMFLELTLGSAEDLLLAFMAY
DRYVAICHPLNYTILMSQKVCCLMIATSWILASLSALGYSIYTMQYPFCKSRQIRHLFCE
IPPLLKLACADTSTYELMVYVMGVTLLIPPLAAILASYSLILFTVLHMPSNEGRKKALVT
CSSHLTVVGMWYGGAIVMYVLPSSFHSPKQDNISSVFYTIFTPALNPLIYSLRNKEVTGA
LRRVLGKRFSVQST