Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

Back to all Rat symbols

Rat Or2ag21-ps Olfactory Receptor

Gene Symbol Or2ag21-ps
Organism Rat
Family 2
Subfamily ag
Pseudo Yes
Location chr9:3989423-3990025 (+)
Aliases Olr212-ps

Sequence information


Nucleotide sequence

AATGAAAACATTAAATATGTATCAATTTATAAATTCTGTACCAAAGTAAGAAATTATAAC
TTCAATTTTGGATCAATTATAAAGATTTCTATCAATATAAAATTATGGCTACACAATGTT
TTGTTCAAGAATAAATTTAGTAATTCATCCCATTTCCTTCATATTCAAAATTATAACCAT
TTCCAAATTATCCTTTAAAATGACAACCTATCTATAATTTATAAAATAACCATAACCAGA
TTCCCAAGCCCAAGGGATTGGGATGACTTGTTGCACCCACTTGATTGGGTTGGGTTGTCT
GTGAGGGTGCCACTTTCATGTATGTGCTGCCAAGTTCCTTCCACAGTCCCAAGCAAGACA
ATATCATCTCTGTGTTCTATACAATTGCTACACCAGTTCTGAATCCCCTCATTTACAGCC
TGAGGAATAAAGCAGTCATTGGAACTTTTAGAAAGGTACTGAGGAGACATATTCTGCCAG
CACACTCCACTCTTTAAGAATGATTCATGTTGTGGTTTGCCCTGAAGTTATCTGTACTTT
GATGCTAATTCCACTGCCCCAAGGACAGCTGCCTAGTCACATACTCAGAAATCAGGTGAC
TTC


Conceptual translation

MTCCTHLIGL\VCEGATFMYVLPSSFHSPKQDNIISVFYTIATPVLNPLIYSLRNKAVI
GTFRKVLRRHILPAHSTL