Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

Back to all Rat symbols

Rat Or2ag2b Olfactory Receptor

Gene Symbol Or2ag2b
Organism Rat
Family 2
Subfamily ag
Pseudo No
Location chr1:170796232-170797218 (+)
Aliases Olr210

Sequence information


Nucleotide sequence

ATGCATGTGTTTTCCAGGAAGCAGAAAAGACCTCTCAGAATGAAACCCTACAACTCCACC
TTGGGAAGTGGATTCATCTTGGAGGGGATTCTGGATGGCAGTGGCTCTCCTGAATTGCTC
TGTGCCATAGTTGCATCCTTGTACATGTTGGCACTGACCAGCAATGGACTGCTATTACTA
GTCATCACAGTTGATGCCCGACTTCATGTACCCATGTACCTTCTACTGAGGCAGCTGTCT
CTCATTGACCTCCTTTTCACATCAGTTGTAACTCCCAAGACTGTTGTGGATTTTCTGCTC
AGAAACAACAACATATCCTTTGAGGGATGTGCCCTTCAATTGTTTTCAGCAATGACATTG
GGTGGTGCAGAGGACCTCCTCCTGGCCTTCATGGCCTATGACAGGTATGTGGCCATTTGT
CGCCCTTTGGACTACATGATCTTCATGAGTCCAAAGGCCTGCTGGCTTATAGTGGCTACA
TCATGGATCCTGGCATCCCTTAGTGCCCTAGGTCACACAGTTTACACAATGCACTTCCCT
TTCTGCATGTCCCAGGTAATCAGACACCTGCTCTGTGAGGTTCCTCCATTGTTGAAGTTG
GCTTGTGCTGATACATCTCAATATGAGCTCATGGTTTATGTGACAGGAGTGACATTCCTA
TTGCTCCCCCTATCTGCCATTGTTGCCTCCTACTCACTAATTCTGTTCACTGTGCTGCAC
ATGCCTTCAAATGAGGGGAGGAAGAAAGCTTTTGTCACCTGTTCCTCCCACTTGACAGTG
GTTGGGATGTTTTATGGGGGTGCCACTTTCATGTATGTGCTGCCCAGTTCCTTCCACAGT
CCTAAGCAAGACAATATCATTTCTGTATTTTATACAATTATCACCCCAGCTCTGAATCCC
CTCATTTACAGCCTGAGGAATAGGGAGGTCATTGGAGCTTTTAAAAGGGTACTGGGGAGA
CGTATTCTGCCAGCACACTCCACCCTT


Conceptual translation

MHVFSRKQKRPLRMKPYNSTLGSGFILEGILDGSGSPELLCAIVASLYMLALTSNGLLLL
VITVDARLHVPMYLLLRQLSLIDLLFTSVVTPKTVVDFLLRNNNISFEGCALQLFSAMTL
GGAEDLLLAFMAYDRYVAICRPLDYMIFMSPKACWLIVATSWILASLSALGHTVYTMHFP
FCMSQVIRHLLCEVPPLLKLACADTSQYELMVYVTGVTFLLLPLSAIVASYSLILFTVLH
MPSNEGRKKAFVTCSSHLTVVGMFYGGATFMYVLPSSFHSPKQDNIISVFYTIITPALNP
LIYSLRNREVIGAFKRVLGRRILPAHSTL