Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

Back to all Mouse symbols

Mouse Or2ah1 Olfactory Receptor

Gene Symbol Or2ah1
Organism Mouse
Family 2
Subfamily ah
Pseudo No
Location chr2:85,823,000-85,823,900 (+)
Aliases Olfr1018

Sequence information


Nucleotide sequence

MDHMKTNFTVTEFVFLGLSSDPKVQLVLFFVFLFFYMLSVVGNIIIITIIQIEPRLKTPM
YFFLANLSFLDICYTSTNVPQMLSNMVGSKKTIPFASCATQMYFSLSFGMIECVLLGVMA
YDRYVAICHPLHYTVIMDQNTCIQLAAISWSSSFLSSMVINVLTLSLPYCGPNVLNHFFC
EVPSVLRLACTDTSLTELVVFVFSIIIVFIPFLLIIVSYARILLSVLRMRSASGRHKALS
TCASHLTVVTLFYGTAIFMYMRPQSKSSRAGGKVIAVFYTVVTPMLNPLIYSLRNQDVKG
SLRRAITKQKT


Conceptual translation

MDHMKTNFTVTEFVFLGLSSDPKVQLVLFFVFLFFYMLSVVGNIIIITIIQIEPRLKTPM
YFFLANLSFLDICYTSTNVPQMLSNMVGSKKTIPFASCATQMYFSLSFGMIECVLLGVMA
YDRYVAICHPLHYTVIMDQNTCIQLAAISWSSSFLSSMVINVLTLSLPYCGPNVLNHFFC
EVPSVLRLACTDTSLTELVVFVFSIIIVFIPFLLIIVSYARILLSVLRMRSASGRHKALS
TCASHLTVVTLFYGTAIFMYMRPQSKSSRAGGKVIAVFYTVVTPMLNPLIYSLRNQDVKG
SLRRAITKQKT