Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

Back to all Rat symbols

Rat Or2ah1 Olfactory Receptor

Gene Symbol Or2ah1
Organism Rat
Family 2
Subfamily ah
Pseudo No
Location chr3:73,204,400-73,205,400 (+)
Aliases Olr461

Sequence information


Nucleotide sequence

ATGGGCCACATGAAAATAAACTCTACAGTGACTGAGTTTGTGTTTCTGGGGCTTTCATCT
GATCCCAAGGTACAGCTTGTCCTCTTTTTTGTATTCTTGTTTTTCTATATGTTGTCAGTG
GTGGGCAATATCATCATCATCACTATTATCCTGATAGAACCTCGCCTGCAAACCCCCATG
TACTTCTTCCTCACTAACTTGTCCTTTCTGGACATCTGCTACACATCCACCAATGTCCCG
CAGATGCTTTCCAACATGGTGTGGGGTAAGAAGACCATCCCATTTGCCAGTTGTGCCACT
CAGATGTACTTCTCACTCTCCTTCGGAATGATTGAGTGTGTTCTTCTTGGTGTCATGGCT
TATGATAGATATGCAGCCATTTGTCATCCTCTCCATTACACTGTTATCATGGACCAAAAC
ACTTGTGTTCAACTGGCAGCCATTTCTTGGTCTAGTAGCTTCCTGAGTTCCATGGTTATC
AATGTTCTCACCTTGAGTTTGCCCTACTGTGGACCAAATGTCCTGAATCACTTTTTCTGT
GAAGTTCCTTCAGTTCTGAGACTGGCTTGTACTGACACTTCACTCACTGAACTGGTGGTT
TTTGTATTCAGTATCATCATTGTCTTCATTCCTTTCCTCCTTATTATTGTTTCCTATGCC
CGCATCCTTCTTTCTGTTCTCAGGATGCGATCAGCCTCTGGGAGGTACAAGGCTCTGTCC
ACCTGTGCCTCCCATCTCACGGTTGTGACTTTATTCTATGGAACTGCCATCTTTATGTAC
ATGAGACCCCAGTCAAAGTCCTCCAGGGCTGGTGGTAAGGTCATTGCAGTATTCTACACT
GTAGTTACACCTATGCTCAATCCATTAATTTACAGCCTAAGGAACCAGGATGTCAAAGGA
TCTCTAAGGAGAGCTCTCACAAAACAAAAGACA


Conceptual translation

MGHMKINSTVTEFVFLGLSSDPKVQLVLFFVFLFFYMLSVVGNIIIITIILIEPRLQTPM
YFFLTNLSFLDICYTSTNVPQMLSNMVWGKKTIPFASCATQMYFSLSFGMIECVLLGVMA
YDRYAAICHPLHYTVIMDQNTCVQLAAISWSSSFLSSMVINVLTLSLPYCGPNVLNHFFC
EVPSVLRLACTDTSLTELVVFVFSIIIVFIPFLLIIVSYARILLSVLRMRSASGRYKALS
TCASHLTVVTLFYGTAIFMYMRPQSKSSRAGGKVIAVFYTVVTPMLNPLIYSLRNQDVKG
SLRRALTKQKT