Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

Back to all Mouse symbols

Mouse Or2aj5 Olfactory Receptor

Gene Symbol Or2aj5
Organism Mouse
Family 2
Subfamily aj
Pseudo No
Location chr16:19605728-19606666 (-)
Aliases Olfr170, MOR273-2

Sequence information


Nucleotide sequence

ATGATGGAATATGAGAACTACACTTTTAACGACTTCATCCTCTTGGGACTGTTCTCTTCT
TCAAAGACAAGTTTAACTTTTTTCTCAGTTATATTTTTCATTTTTATTATGGCTATAACA
GAAAATGCCCTCATGATCCTCCTAATCCACAGGGATTCTCGACTCCATACCCCAATGTAT
TTTCTGCTCAGTCATCTCTCCTTCATGGATATCTTGCACATTTCCAACATTGTTCCTAAA
ATGATTGCTGACTTCCTCTCAGGCAGCAGAACTATTTCCTTTGCAGGCTGTGCCTTCCAG
ATATTTCTCTCTCTTACCTTGCTAGGTGGTGAGTGCCTTCTCCTGGCAGCCATGTCCTAT
GATCGATATGTGGCCATCTGCCACCCACTTTGCTACCCTGTGCTGATGAGGGATAACTTC
AGTAGGCTCCTGGCTGCAGGCTCCTGGCTGGTGGGGATCCTCAACTCCATAGTCCACACA
GCTTTTGTACTACACTTTCCCTTCTGCCACTCAAGGGCCATTGATCACTTTTTCTGTGAA
GTCCCTGCCATGTTGAAGTTGTCATGTATAGACACAACACACTATGAGCAAGGAGTTTAT
GTGAGTGGCATTATTTTTCTGATGGTCCCATTTTCCATGATCTCTATATCTTATGTGCAA
ATTCTCCTCACTGTATTCCAAATGCACTCATCAGGGGCCCGGCAAAAGTCCTTTTCCACC
TGTTTATTCCACATGGTAGTTGTCATAATGTACTATGGGCCAGTCATTTTCACATATATG
AGACCTCGCTCATACCACACTCCAGGGCAGGATAAGTTTCTGGCAATATTCTACACCATC
TTGACACCCAAACTCAACCCCATAATCTATAGCTTTCGGAATAAAGATGTCCTCAGGGCT
TTGAAAAACATAGTCCAAAGTAATATTCTGAATAAAAAA


Conceptual translation

MMEYENYTFNDFILLGLFSSSKTSLTFFSVIFFIFIMAITENALMILLIHRDSRLHTPMY
FLLSHLSFMDILHISNIVPKMIADFLSGSRTISFAGCAFQIFLSLTLLGGECLLLAAMSY
DRYVAICHPLCYPVLMRDNFSRLLAAGSWLVGILNSIVHTAFVLHFPFCHSRAIDHFFCE
VPAMLKLSCIDTTHYEQGVYVSGIIFLMVPFSMISISYVQILLTVFQMHSSGARQKSFST
CLFHMVVVIMYYGPVIFTYMRPRSYHTPGQDKFLAIFYTILTPKLNPIIYSFRNKDVLRA
LKNIVQSNILNKK