Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

Back to all Rat symbols

Rat Or2ak4b-ps Olfactory Receptor

Gene Symbol Or2ak4b-ps
Organism Rat
Family 2
Subfamily ak
Pseudo Yes
Location chr10:44594231-44595346 (-)
Aliases Olr1446-ps

Sequence information


Nucleotide sequence

TCTATCCCATGTAATAAATGTCATTTTCCTTCTCAAGGAGAGTCCTCACCAGACCATGCC
ATTTCCAGATTGTATCTGCTTTGATGGTTCAGTCTAAGGCATGGAGACAGGAAACCACAG
CTGTGGGACAGACTTCACCTTGGTTGGTCTTTTCCAGTATGGACACATGGACACTTTCCT
CTTCACAGTCATCACCCTCCTCTTTGCAGTGGCTCTCATAGGCAACATCACACTGGTCCA
CCTCATCAGGCTGGACCAAACACTCCACACCCCAATGTACTTCCTCCTCAACCAGCTCTC
CATCATCGACATGATGTACATCTCTACCACTGTGCCCAAGATGGCAGCTAACTTCCTGTT
AGACACCAAGACCATTTCCTTTCTGGGATGTGCCATCCAAGCCTCTGTGTTTCTGACTCT
GGGTGGGTCTGAAGCCCTCCTGCTGGGTTTCATGTCCTATGACAGGTACATAGCCATTTG
CCATGAACTACCCTTTGCTCATGAACAGGAAGATCTGCTACTCCATGGTTGCCAGTGCCT
GGAGCAGTAGCTTTATTACAACATTAATGCACATACTGTATGTATTTCAACTTCCCTTTT
GTGGATCTAGGATTGTTAACCACTTTTTCTGTGAGGTTCCATCTCTCCTGCCATTGGTGT
GTGAAGACACGTCCCAATATGAGCATACAGTCCTCGTGAGTGGCCTTGTCTTTCTCTTAT
TACCCTTCCTGGGCATCCTAGCTTCCTATGCTCGGGTGTTGGTTGTTGTATTCCAGATGG
GTTCAGGGAAGGGACAGAGTAGAGCAGTGTCCACCTGCTCTTCCCACCTGACTGTGGCCA
GCCTGTTCTATGTCACTGCTCTTTGCACCTACACCCAGCCGCACTCCTTGCATTCTCCTG
GGAGGGACAAAGTGGTGGCTGTGGTCTACTCTATCATCACCCCTGTTCTGAACCCTTTCA
TCTACAGCCTGAGGAACAAGGAGGTCATGGGGGCCCTGAGGAGACATATGGGATGATGCA
TATAGACACTGAAAGTGGGTCTTTGGGTCACTTTGTGGACTGATCTAAAGGCTGATCTTG
ACACTCTCAGGAACAATTTCAGGATGGATGTTCTGA


Conceptual translation

METGNHSCGTDFTLVGLFQYGHMDTFLFTVITLLFAVALIGNITLVHLIRLDQTLHTPMY
FLLNQLSIIDMMYISTTVPKMAANFLLDTKTISFLGCAIQASVFLTLGGSEALLLGFMSY
DRYIAIC\NYPLLMNRKICYSMVASAWSSSFITTLMHILYVFQLPFCGSRIVNHFFCEV
PSLLPLVCEDTSQYEHTVLVSGLVFLLLPFLGILASYARVLVVVFQMGSGKGQSRAVSTC
SSHLTVASLFYVTALCTYTQPHSLHSPGRDKVVAVVYSIITPVLNPFIYSLRNKEVMGAL
RRHMG