Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

Back to all Rat symbols

Rat Or2ak4e Olfactory Receptor

Gene Symbol Or2ak4e
Organism Rat
Family 2
Subfamily ak
Pseudo No
Location chr10:44547564-44548481 (+)
Aliases Olr1443

Sequence information


Nucleotide sequence

ATGGAGATAGGAAACCACAGCTGTGGGACAGACTTCACCTTGGTTGGTCTTTTCCAGTAT
GGACACATGGACACTTTCCTCTTCACAGTTATCACCCTCCTCTTTGCAGTGGCTCTCATA
GGCAACATCACACTGGTCCACCTCATCAGCCTGGACCGAATACTCCACACCCCCATGTAC
TTCCTCCTCAGCCAGCTCTCCATCATTGACATGATGTACATCTCCACCACTGTGCCCAAG
ATGGCAGCTAACTTCCTGTCAGACACCAAGACCATTTCCTTTCTGGGATGTGCAATCCAA
GCCTTTATGTTTCTGACCCTGGGTGGGTCTGAAGCCCTCATGCTGGGTTTCATGTCCTAT
GACAGATACATAGCCATTTGCCAGCCCTTGCACTACCCTGTGCTCATGAGCAGGAAGATC
TGCTGCTCTATTATCACCAGTGCCTGGAGCAGCAGCTCCATCACTGCATTAATACACATA
CTGTATGTATTTCAACTTCCATTCTGTGGATCTAGGATTGTTAACCACTTTTTCTGTGAG
GTTCCATCTCTCCTGCCATTGGTGTGTGAAGACACGTCCCAATATGAGCATGCAGTCCTC
CTGAGTGGCCTTGTCATTCTGTTGTTACCCTTCCTGGCCATCCTAGCTTCCTATGCTCGG
GTGTTGGTTGTTGTATTCCAGATGGGTTCAGGGAAGGGACAGAGTAGAGCAGTGTCCTCC
TGCTCTTCCCACCTGACTGTGGCCAGCCTGTTCTACATCACTACTCTCTCCACCTACACC
CAACCACACACTTTGCATTCTCCTGGGAGGGACAAAGTGGTGGCTGTGGTCTACTCAATT
GTTACTCCTGTTTTGAACCCATTCATCTATAGCCTGAGGAACAAGGAGGTCATGGGGGTT
CTAAAAAGACAAATGGGA


Conceptual translation

MEIGNHSCGTDFTLVGLFQYGHMDTFLFTVITLLFAVALIGNITLVHLISLDRILHTPMY
FLLSQLSIIDMMYISTTVPKMAANFLSDTKTISFLGCAIQAFMFLTLGGSEALMLGFMSY
DRYIAICQPLHYPVLMSRKICCSIITSAWSSSSITALIHILYVFQLPFCGSRIVNHFFCE
VPSLLPLVCEDTSQYEHAVLLSGLVILLLPFLAILASYARVLVVVFQMGSGKGQSRAVSS
CSSHLTVASLFYITTLSTYTQPHTLHSPGRDKVVAVVYSIVTPVLNPFIYSLRNKEVMGV
LKRQMG