Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

Back to all Rat symbols

Rat Or2ak5f Olfactory Receptor

Gene Symbol Or2ak5f
Organism Rat
Family 2
Subfamily ak
Pseudo No
Location chr10:44527468-44528379 (+)
Aliases Olr1442

Sequence information


Nucleotide sequence

ATGGGGACAGGCAACCACAGCTGTGGGACAGACTTCACCTTGGTTGGTCTATTCCAGTAT
GGACACATGGACACTTTCCTCTTTACAATCATCACCCTCCTCTTTGCAGTGGCTCTCATG
GGCAACATCACACTAGTCTACCTCATCAGGCTGGACCGAATACTCCACACCCCCATGTAC
TTCCTCCTCAGCCAGCTCTCCATCATTGACATGATGTACATCTCCACCACTGTGCCCAAG
ATGGCAATGAACTCCTTGTCAGACACCAAGACCATTTCTTTTCTGGGATGTGCAATCCAA
ACCTTTTTATTTCTGACCCTGGGTGGGTCTGAAGCCCTCCTGTTGGGCTTCATGTCCTAT
GACAGGTACATAGCCATCTGTCAGCCCGTGCACTACCCTGTGCTCATGAGCAGGAAGATC
TGCTGCTCTATTGTCACCAGTACATGGAGTAGTAGCTCCATCACTGCATTAATGCACATA
ATCTATTTATTTCAACTTCCATTATGTGGATCTAGGATTAACCACTTTTTCTGTGAGGTT
CCATCTCTCCTGCCACTGGTGTGTGAAGACACGTCCCAATATGAGCATGCAGTCCTCATG
AGTGGCCTTGTCATTCTGTTGTTACCCTTCCTGGCCATCCTAGCTTCCTATGCTCGGGTG
TTGGTTGTATTCCAGATGGGTTCAGGGAAGGGACAGAGTAGAGCAGTGTCCACCTGCTCC
TCCCACTTGACTGTGGCCAGCCTGTTCTACATCACTACTCTCTCCACCTACACCCAACCA
CACACTTTGCATTCTCCTGGGAGGGACAAAGTGGTAGCTGTGATCTACTCAATTGTCACC
CATGTTTTGAACCCGTTCATCTACAGCCTGAGGAACAAGGAGGTCATGTGGGCCCTAAAA
AGACAAATGGGA


Conceptual translation

MGTGNHSCGTDFTLVGLFQYGHMDTFLFTIITLLFAVALMGNITLVYLIRLDRILHTPMY
FLLSQLSIIDMMYISTTVPKMAMNSLSDTKTISFLGCAIQTFLFLTLGGSEALLLGFMSY
DRYIAICQPVHYPVLMSRKICCSIVTSTWSSSSITALMHIIYLFQLPLCGSRINHFFCEV
PSLLPLVCEDTSQYEHAVLMSGLVILLLPFLAILASYARVLVVFQMGSGKGQSRAVSTCS
SHLTVASLFYITTLSTYTQPHTLHSPGRDKVVAVIYSIVTHVLNPFIYSLRNKEVMWALK
RQMG