Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

Back to all Rat symbols

Rat Or2ak6c Olfactory Receptor

Gene Symbol Or2ak6c
Organism Rat
Family 2
Subfamily ak
Pseudo No
Location chr10:44407475-44408392 (+)
Aliases Olr1437

Sequence information


Nucleotide sequence

ATGGAGACAGGAAACCACAGCTGTGGGACAGACTTCACCTTGTTTGGTCTTTTCCAGTAT
GGACACATGGACACCTTCCTCTTCACAGTCATTGCCCTCCTGTTTGCAGTGGCTCTCATA
GGAAACATCACACTGGTCCACCTCATCAGACTGGACCGAACACTCCACACCCCCATGTAC
TTTCTCCTCAGCCAGGTCTCCATCATCGACATGATGTACATTTCCACCACTGTGCCCAAG
ATGGCAATTAACTTCCTGTCAAACACCAAGACCATTTCCTTTCTAGGATGTCTGATCCAA
GTCTTTACGTTTTTGACTCTTGCTGGCTGTGAAGCCCTCCTGCTGGGTTTCATGTCCTAT
GACAGGTATATAGCCATCTGCCAGCCCTTGCGCTATTCTGTGCTCATGAGCAGGAAGATC
TGCTGCTCCATGGTCGCTGGTGCCTGGAGTAGCAGCTCCATCAATGCTTTAGTGCACACA
GTGTATGTATTTCAGCTTCCATTCTGTGGATCTAGGATTGTTAACCACTTTTTCTGTGAT
ATTCCATCTCTTCTGTCACTGGTGTGTGAAGACACATCCCAATATGAGCATTTGATTGTC
ATGAGTGTCCTTGTCCTTGTGCTGATACCCTTCCTGGCCATCCTAGCTTCCTATGCTCGG
GTGCTGGTTGTTGTATTCCAGATTGGTTCAGGGAAGGGACAGAGTAGAGCAGTGTCCACC
TGCTCCTCTCACCTGACTGTGGCCAGCCTGTTCTATGTCACTACTTTCTCCACCTACACC
CAGCCACACTCCTTGCATTCTCCTGGGAGGGACAAAGTGGTGGCTGTGCTCTACTCTATC
ATCACCCCTGTTCTGAACCCGTTCATCTACAGCCTGAGAAACAAGGATGTCATGGGAGCC
CTGAGGAGACAAATGGGA


Conceptual translation

METGNHSCGTDFTLFGLFQYGHMDTFLFTVIALLFAVALIGNITLVHLIRLDRTLHTPMY
FLLSQVSIIDMMYISTTVPKMAINFLSNTKTISFLGCLIQVFTFLTLAGCEALLLGFMSY
DRYIAICQPLRYSVLMSRKICCSMVAGAWSSSSINALVHTVYVFQLPFCGSRIVNHFFCD
IPSLLSLVCEDTSQYEHLIVMSVLVLVLIPFLAILASYARVLVVVFQIGSGKGQSRAVST
CSSHLTVASLFYVTTFSTYTQPHSLHSPGRDKVVAVLYSIITPVLNPFIYSLRNKDVMGA
LRRQMG