Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

Back to all Rat symbols

Rat Or2av10 Olfactory Receptor

Gene Symbol Or2av10
Organism Rat
Family 2
Subfamily av
Pseudo No
Location chr10:43911950-43912963 (-)
Aliases Olr1414

Sequence information


Nucleotide sequence

ATGATATTCAAAGGAGGTGATTCTGATCACATTTCTAATGTTTTCTCTGCACTGCCTAGC
TCAATGCTGGAAGTCCAGGACATTAGCAGAGGGAATGGGACCTCAACAGATTTCATTCTC
CTGGGGCTTTTCCCAGAGCTGCGCTATCTGGGCATCCTCATCATTTCTATTCTCCTGATC
TATCTCATCGCGTTCACGGGGAATGCTGTCCTGGTCCTCTTGATCTGGGCAGACTCTCGC
CTCCACACCCCAATGTACATTCTACTCAGCCACCTCTCTCTTATTGACTTGGCCTTAATT
TCCACCACTGTCCCGAAGATGGTTATCAACTTTTTCTCCAGGAAGAAAAGCATCTCCAAA
GTTGCCTGTGGGACCCAGATTTTCTTTTTCTTTGCCCTTGGGGGTAGTGAGTGTCTCCTT
CTGACCCTCATGGCTTATGACCGCTATGTGGCTGTCTGTAATCCCTTGAGATATTCAATT
ATCATGAACTCTAGAGTCTGTCTGTGGATGGCCCTTGTATCCTGGGGTGGAGGTGCCCTG
AATTCTCTCATCAACACCATCTACACCATGCACTTCCCATTCTGTGGCTCTAGGGAAATC
CACCACTTCTTCTGTGAGATGCCTGCTGTCCTGAGGCTCTCTTGTGAGGACACTTCCTTG
TATGAGACGGTGGTATCCATCATCTGCATCGTGTTTGTTCTTCTCCCTTTGGGACTCATC
ATGACCTCTTACCTGCTCATCTTCCTCGCTGTCCTCCGAATGAATTCCCCAGAGGGCAGG
AGGAAAGCGCTGGCCACGTGTTCTTCTCACCTGGCAGTTGTGAGCCTCTACTATGGGCCA
GCCATGATCATCTACATGACCCCTGACTCTTTCCACACTCCAGAACAAGATGAAATACTC
TCCATGATTAACACCATCTTCACTCCCATGCTCAACCCTCTCATCTACAGCCTGAGGAAC
AAGGAGGTGCTTGCTGCCCTGAGAAAAGTAGTGAGTCAACGATTCATTTTAAAG


Conceptual translation

MIFKGGDSDHISNVFSALPSSMLEVQDISRGNGTSTDFILLGLFPELRYLGILIISILLI
YLIAFTGNAVLVLLIWADSRLHTPMYILLSHLSLIDLALISTTVPKMVINFFSRKKSISK
VACGTQIFFFFALGGSECLLLTLMAYDRYVAVCNPLRYSIIMNSRVCLWMALVSWGGGAL
NSLINTIYTMHFPFCGSREIHHFFCEMPAVLRLSCEDTSLYETVVSIICIVFVLLPLGLI
MTSYLLIFLAVLRMNSPEGRRKALATCSSHLAVVSLYYGPAMIIYMTPDSFHTPEQDEIL
SMINTIFTPMLNPLIYSLRNKEVLAALRKVVSQRFILK