Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

Back to all Rat symbols

Rat Or2ay1-ps Olfactory Receptor

Gene Symbol Or2ay1-ps
Organism Rat
Family 2
Subfamily ay
Pseudo Yes
Location chr20:1117096-1117652 (-)
Aliases Olr1703-ps

Sequence information


Nucleotide sequence

TAGACATGACATGGCCACTGTACTCATGAAATCACAGTAGCTATGATGACTACACTAGAG
CTACACAGATGAACCCAGCCAAAAACCTAGCATAGATGGAGAATGTGTACTTCTCTCCAT
CATGGCCTTTGATTGCTTTGTGACTATCCTCCAACCTCTGCTTGCACAGTTATGCACAAT
TGGTTTCAGCAACTCCTTGGTGCAGAGTGTTGCCGTCTTTGTTATCTTGTGGTTGTAGCC
TAGACCAGGTAGAGCATTTCTTGTGTGAGGTACGTGCCATTCTTCAGTTATCATGCTTTG
ACACCTGGGTCAATGAGGTAGAGTTGTATGTTGCTGTGGTTGATATAAAAGTTACCCATC
CCTTTTGGGTTGATTCTTCCCTCTTATGTCAATGTAGTCAGAGCAGTCATAGGATACAAT
CTTCTGAAGGTTAAAAGCAGGCCTTTACACATGTGGCTCTCATATAATTAACAGGCAAAG
TGACAAATCAGAGAAATTTTTTTACAGATTGAATCAAAAACAGATCCACTCAACTCCTCT
AAGGACAAGAAAGAGGC


Conceptual translation

MAFDCFVTILQPLLAQLCTIGFSNSLVQSVA\LLSCGCSLDQVEHFLCEVRAILQLSCF
DTWVNEVELYVAVV\*KLPIPFGLILPSYVNVVRAV/RIQSSEG*KQAF