Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

Back to all Mouse symbols

Mouse Or2d36 Olfactory Receptor

Gene Symbol Or2d36
Organism Mouse
Family 2
Subfamily d
Pseudo No
Location chr7:107147318-107148259 (+)
Aliases Olfr716, MOR260-2

Sequence information


Nucleotide sequence

ATGGGAAGAGAAAACCAGAGCTTTGTAGATGAATTTGTGTTGCTGGGCCTTTCGCAAGAT
GCACAGACTCAGATCCTCCTGTTTGTCCTTTTCTTCATCGTTTACATTCTGACTGTACTT
GGAAACCTGCTCATCATTGTCCTCATCCTCATGGATTCTCGACTCCACACCCCCATGTAC
TTTTTTCTTAGAAATCTTTCTTTTGCAGATCTCTGTTTCTCAAATAGCATTGTTCCTCAA
GTGCTGTCCCACTTCCTGGTAAAAAGGAAAACTATTTCCTTTTGGGGCTGTGTGACACAG
GTAATTGTCTCCCTTCAGATTGGGTGTACAGAGTGTGCACTGCTGGCGGTGATGTCCTAT
GACCGCTATGTGGCTGTGTGCAAACCACTGCACTACTCCACCATCATGACCCAACAACTA
TGCCTGCAGTTGGCCCTAGGGTCCTGGGCCAGTGGGCTCCTAGTATGTTTGGTAGATATT
GCTGTTGCTTTCCATCTTCCCTATCGAGGGCAGAACATAGTCAGCCATTACTTTTGTGAA
CTTCCTGCACTTCTGAAGGTGGCTTCAGCAGATACTTACAGCACAGAAATGGCCATCTTT
GCAATGGGTGTGGTAATCCTCCTAGCACCTGTCTCCCTCATCCTCATCTCCTACTGGAAC
ATCATATCCACTGTGATCCAGATGCAGTCTGGAGAGGGGAGACTCAAGGTGTTCTCAACC
TGTGGATCTCACCTCATTGTTGTTGTCCTCTTCTATGGGTCTGCAATATTTAACTATATG
CAGCCAAACACCAAAACTAGGAAGAAACAGGATAAGATAATGTCTGTGTTCTATACAGTG
GTGACTCCAATGCTAAACCCCATAATTTATAGTCTTCGGAACAAGGATGTCAAAAGTGCC
TTCAGGAAACTAGCTGCAAGAGTGGTATTCTTTCGAAAGCAA


Conceptual translation

MGRENQSFVDEFVLLGLSQDAQTQILLFVLFFIVYILTVLGNLLIIVLILMDSRLHTPMY
FFLRNLSFADLCFSNSIVPQVLSHFLVKRKTISFWGCVTQVIVSLQIGCTECALLAVMSY
DRYVAVCKPLHYSTIMTQQLCLQLALGSWASGLLVCLVDIAVAFHLPYRGQNIVSHYFCE
LPALLKVASADTYSTEMAIFAMGVVILLAPVSLILISYWNIISTVIQMQSGEGRLKVFST
CGSHLIVVVLFYGSAIFNYMQPNTKTRKKQDKIMSVFYTVVTPMLNPIIYSLRNKDVKSA
FRKLAARVVFFRKQ