Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

Back to all Rat symbols

Rat Or2d36b Olfactory Receptor

Gene Symbol Or2d36b
Organism Rat
Family 2
Subfamily d
Pseudo No
Location chr1:170693931-170694872 (-)
Aliases Olr229

Sequence information


Nucleotide sequence

ATGGGAAGAGAAAACCAGACCTTTGTAGTTGAGTTTTTGTTGCTTGGCCTTTCACAAGAT
GCACAGACTCAGATTCTCCTGTTTGTTCTTTTCTTCATCATTTATGTGCTGACTGTACTT
GGAAACCTGCTCATCATTATCCTCATTCTTATGGATTCTCGACTCCACACCCCCATGTAT
TTTTTTCTTAGAAACCTCTCTTTTGCTGATCTCTGCCTCTCAAGTAGCATTGTTCCTCAA
GTGCTGTCCCACTTCCTGGTAAAAAGGAAAACCATTTCCTTTTGGGGCTGTGTGACACAG
GTAATTGTCTCTCTTCAGATTGGGTGTACAGAGTGTGCACTGCTAGCTGTGATGTCCTAT
GACCGGTATGTGGCTGTGTGCAAGCCACTACACTACTTTACTGTCATGACCCAACAACTA
TGCCTGCAGTTGGCCCTAGGGTCCTGGGCCAGTGGGCTCCTAGTATCCCTGATAGATATT
ACTGTTGCCTTCCATCTTCCCTATCAAGGGCAGAACACAGTCAGTCATTACTTTTGTGAA
CTTCCTGCTCTCCTGAAAGTGGCTTCAGCAGATACTTACAGCACAGAAATGGCCATCTTT
GCAATGGGCATTGTAATTCTCCTAGCACCTGTCTCCCTCATCCTCATCTCCTACTGGAAC
ATCATCTCCACTGTGATCCAGATGCAGTCTGGAGAGGGGAGACTCAAGGCTTTTTCAACC
TGTGGATCTCATCTCATTGTTGTTGTCCTCTTCTATGGGTCTGGAATATTTAACTATATG
CAGCCAAACACCAAAACAACAAGGAAGCGGGATAAGATAATGTCTGTGTTCTATACAGTT
GTGACTCCAATGTTAAACCCCATAATTTATAGTCTGAGGAACAAGGATGTCAAAAGTGCC
TTCAAAAGACTAGCAGCAAGAATAGCCTTCTTTCAGAAGCAG


Conceptual translation

MGRENQTFVVEFLLLGLSQDAQTQILLFVLFFIIYVLTVLGNLLIIILILMDSRLHTPMY
FFLRNLSFADLCLSSSIVPQVLSHFLVKRKTISFWGCVTQVIVSLQIGCTECALLAVMSY
DRYVAVCKPLHYFTVMTQQLCLQLALGSWASGLLVSLIDITVAFHLPYQGQNTVSHYFCE
LPALLKVASADTYSTEMAIFAMGIVILLAPVSLILISYWNIISTVIQMQSGEGRLKAFST
CGSHLIVVVLFYGSGIFNYMQPNTKTTRKRDKIMSVFYTVVTPMLNPIIYSLRNKDVKSA
FKRLAARIAFFQKQ