Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

Back to all Rat symbols

Rat Or2d3c Olfactory Receptor

Gene Symbol Or2d3c
Organism Rat
Family 2
Subfamily d
Pseudo No
Location chr1:170988314-170989234 (-)
Aliases Olr221

Sequence information


Nucleotide sequence

ATGGGTGAACACAACAGAACTTCTGTGACAGAATTCATCCTTCTGGGCCTCTCACAGGAT
CCACAAACCCAAGTCCTGCTCTTCTTCCTTTTCCTCCTCATCTACCTGCTCACTGTGCTG
GGAAACCTGCTGATCATTGTGCTCATCCACTCAGACCCCAGACTCCACACCCCCATGTAC
TTTTTCCTTAGAAACCTGTCTTTTGCTGATCTCTGCTTTTCTACTACCACAGTGCCCCAG
GTGCTTGTGCACTTCCTGGTGAAGAGGAAGGCCATTTCTTTTGCTGGCTGCTCCATACAA
TTAGTTATGTTACTTCTAGTAGGGTGTACAGATTGTGCACTGCTAGCAGTGATGTCCTAT
GACCGCTATGTGGCTGTCTGCAAGCCACTACACTACTCCACTATCATGACACACTGGGTA
TGTGTCCAGCTGGCTGCAGGGTCCTGGGCTAGTGGCGTACTTGTGTCTCTGGTAGATGCC
ACATTCACATTGCGTCTTCCTTATCGAGGAAACAATGTCATTAACCACTTTTTCTGTGAG
CCTCCTGCCCTCCTGAAGCTGGCTTCAGCAGATACCTACAGCACAGAAATGGCCATCTTT
GCAATGGGCGTGGTAATCCTCCTAGCACCTGTCTCCCTCATCCTCATCTCCTACTGGAAC
ATTGTCTCTACTGTGATCCAGATGCAGGCTGGAGAAGGGAGACTCAAGGTCTTCTCCACC
TGTGGCTCCCACCTCATTGTAGTTGGTCTCTTCTATGGCTCAGCAATATTTGCCTACATG
AGACCAAATTCAAAGATAATGAATGAAAGAGATAAAATGATTTCGGTGTTCTATTCAGCA
GTGACTCCCATGCTGAACCCCATCATATACAGTCTGAGAAACAAAGATGTCAAAGGGGCT
CTCAGGAGAATAATGTCAAGA


Conceptual translation

MGEHNRTSVTEFILLGLSQDPQTQVLLFFLFLLIYLLTVLGNLLIIVLIHSDPRLHTPMY
FFLRNLSFADLCFSTTTVPQVLVHFLVKRKAISFAGCSIQLVMLLLVGCTDCALLAVMSY
DRYVAVCKPLHYSTIMTHWVCVQLAAGSWASGVLVSLVDATFTLRLPYRGNNVINHFFCE
PPALLKLASADTYSTEMAIFAMGVVILLAPVSLILISYWNIVSTVIQMQAGEGRLKVFST
CGSHLIVVGLFYGSAIFAYMRPNSKIMNERDKMISVFYSAVTPMLNPIIYSLRNKDVKGA
LRRIMSR