Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

Back to all Rat symbols

Rat Or2f1-ps Olfactory Receptor

Gene Symbol Or2f1-ps
Organism Rat
Family 2
Subfamily f
Pseudo Yes
Location chr4:72221979-72222500 (+)
Aliases Olr806

Sequence information


Nucleotide sequence

ATGGCTATTGTATCTTGGGTCAGTGGCTCCATGAACTCAGTCATGCAGACTGCTATCACC
TTCCAACTGCCCATGTGCACAAACAGGTACATCGACCATATATCCTGTGAACTTCTTGCT
GTAGTGAGGCTGGCCTGTGTGGATATCTCTGCCAATGAAGTTGCTATCATGGTATCAAGC
ATCATTCTCCTGATGACCCCTTTCTGCCTGGTTCTCCTATCCTACATCCAGATCATCTCC
ACCATCCTGAAAATCCAGTCCAAAGAGGGAAGAAAGAAAGCCTTCCACACCTGTGCCTCT
CACCTCACTGTGGTAGCTCTGTGCTACGGCATGGCCATTTTCACTTACATACAGCCCCAT
TCCAGCCCGTCTGTCCTTCAGGAAAAGTTGATTTCTCTATTCTATGCAATTTTGACACCC
ATGCTGAACCCCATGATTTACAGTCTGAGGAATAAGGAAGTCAAGGGTGCTTGGCAGAAA
CTACTCGGAAAATTCTCTGGCTTCACATTAAAACTAAAAACC


Conceptual translation

MAIVSWVSGSMNSVMQTAITFQLPMCTNRYIDHISCELLAVVRLACVDISANEVAIMVSS
IILLMTPFCLVLLSYIQIISTILKIQSKEGRKKAFHTCASHLTVVALCYGMAIFTYIQPH
SSPSVLQEKLISLFYAILTPMLNPMIYSLRNKEVKGAWQKLLGKFSGFTLKLKT