Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

Back to all Rat symbols

Rat Or2f5-ps Olfactory Receptor

Gene Symbol Or2f5-ps
Organism Rat
Family 2
Subfamily f
Pseudo Yes
Location chr4:72194875-72195316 (+)
Aliases Olr805-ps

Sequence information


Nucleotide sequence

AATCCTGGCTGTTAGTCCTGTCCTACATCCAGACCATTTCCAGTATCCAGTCCAAAAGAG
ATGATGCACACTGAGCCACAGATCCAGTACAAAGAGGGAAGGAGGAAGGCTTTCCACACG
TGTGCCTCCTACCTCATTATGGTTGCCCTGTACTATGGCATAGCCATTTTACTATCACTC
CAATCCCTCTGTCCTTCAAGAAAAGTTGATTTCTCGGTCTATGCAATTATGACACTCACA
CTGAACCCTCTGATTTACAGTCTAAGGAATAATGAAGTGAAAGGGGCTTGGCAGAAACTA
CTGGAACACTTATACGGATTCACATCAAAACTGAAAACCTGAGGAATCATGAGCATTACT
GGATAAAAGGACTTTGCTTCTATGTTCTGCATTGCCATGGTGATACAGGTGATTAGATTA
GATACTGACACATCATGACTGG


Conceptual translation

LLVLSYIQTISSIQSKRDDAH*A\IQYKEGRRKAFHTCASYLIMVALYYGIAI\YHSN
PSVLQEKLISR/YAIMTLTLNPLIYSLRNNEVKGAWQKLLEHLYGFTSKLKT