Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

Back to all Rat symbols

Rat Or2g25 Olfactory Receptor

Gene Symbol Or2g25
Organism Rat
Family 2
Subfamily g
Pseudo No
Location chr20:1110773-1111723 (+)
Aliases Olr1702

Sequence information


Nucleotide sequence

ATGACAATTAACAAGAGCTCGGGCGGTGATTTCATCCTGGTGGGCTTCTCTGATCAGCCA
CGACTTGAAAAGATCCTCTTTGTGGTGGTGCTGATCTCCTACCTCCTGACACTGGTAGGC
AACACAGCGATCATCCTCGTTTCCTGTTTGGATTCTGCGCTCCGAACGCCCATGTACTAC
TTCCTTACCAACCTTTCTTTCGTTGACATCTGCTTTTCCACCAGCATTGTTCCTCAGCTG
CTGTGGAACCTCCACGGTCCAGCCAAGACAATTACTGCCACAGGCTGCGCTATTCAGCTT
TATGTGTCTCTGGCTCTGGGGTCCACCGAGTGTGTCCTCCTCGCAGTTATGGCATTTGAT
CGCTATGCTGCTGTTTGCCGACCACTTCACTATGCTACCGTTATGCACCCACGGCTCTGC
CAGTCTCTTGCAGGAATAGCATGGCTGAGCGGAGTGGGCAACACACTGATTCAGGGCACC
ATCACCCTCCGCCTGCCTCGCTGTGGGAACCACAGGATTTATCACTTCCTCTGTGAGGTT
CCTGCCATGATCAAGTTAGCATGTGTAGACATTCACGCCAACGAAGTGCAGTTATTCATG
GCTTCTTTGGTGCTGCTCCTCCTTCCCCTGACACTCATCTTGGTATCATATGGGTGCATT
ACCCAAGCACTGATGAGGTTAAGGTCGGCTCTAACCTGGGGCAAAGCTCTTGGAACCTGT
GGATCCCACCTGCTGGTAGTGGTACTATTTTATGGCACAAGCACCGCTGTCTATATTCAT
CCTAACAGCTCCTATGCACAGAGTCAGGGGAAGTTTATCACCCTTCTGTATACCGTGGTT
ATTCCTACTCTAAACCCCCTCATTTACACTTTAAGAAACAAAGATGTAAAGGGAGCTTTG
AAGAGACTGGTGAGAAAAGATAACAGCACTGGAAAGCAAATTCTTCCCAGG


Conceptual translation

MTINKSSGGDFILVGFSDQPRLEKILFVVVLISYLLTLVGNTAIILVSCLDSALRTPMYY
FLTNLSFVDICFSTSIVPQLLWNLHGPAKTITATGCAIQLYVSLALGSTECVLLAVMAFD
RYAAVCRPLHYATVMHPRLCQSLAGIAWLSGVGNTLIQGTITLRLPRCGNHRIYHFLCEV
PAMIKLACVDIHANEVQLFMASLVLLLLPLTLILVSYGCITQALMRLRSALTWGKALGTC
GSHLLVVVLFYGTSTAVYIHPNSSYAQSQGKFITLLYTVVIPTLNPLIYTLRNKDVKGAL
KRLVRKDNSTGKQILPR