Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

Back to all Rat symbols

Rat Or2g7 Olfactory Receptor

Gene Symbol Or2g7
Organism Rat
Family 2
Subfamily g
Pseudo No
Location chr20:637863-638813 (-)
Aliases Olr1686

Sequence information


Nucleotide sequence

ATGACAATTAACAAGAGCTCGGGCGGTGATTTCATCCTGGTGGGCTTCTCTGATCAGCCA
CGACTTGAAAAGATCCTCTTTGTGGTGGTGCTGATCTCCTACCTCCTGACACTGGTAGGC
AACACAGCGATCATCCTCGTTTCCTGTTTGGATTCTGCGCTCCAAACGCCCATGTACTAT
TTCCTTACCAACCTTTCTTTCGTTGACATCTGCTTTTCCACCAGCATTGTTCCTCAGCTG
CTGTGGAACCTCCACGGTCCAGCCAAGACAATTACTGCCACAGGCTGCGCTATTCAGCTT
TATGTGTCTCTGGCTCTGGGGTCCACCGAGTGTGTCCTCCTCGCAGTTATGGCATTTGAT
CGCTATGCTGCTGTTTGCCGACCACTTCACTATGCTACCGTTATGCACCCACGGCTCTGC
CAGTCTCTTGCAGGAATAGCATGGCTGAGCGGAGTGGGCAACACACTGATTCAGGGCACC
ATCACCCTCCGCCTGCCTCGCTGTGGGAACCACAGGATTTATCACTTCCTCTGTGAGGTT
CCTGCCATGATCAAGTTAGCGTGTGTAGACATTCACGCCAACGAAGTGCAGTTATTCATG
GCTTCTTTGGTGCTGCTTCTCCTTCCCTTGACACTCATCTTGGTATCATATGGGTGCATT
ACCCAAGCACTGATGAGGTTAAGGTCGGCTCTAACCTGGGGCAAAGCTCTTGGAACCTGT
GGATCCCACCTGCTGGTAGTGGTACTATTTTATGGCACAATCACCGCTGTCTATATCCAG
CCTAACAGCTCCTATGCACACAGTCGGGGGAAGTTCATCACCCTTCTGTATACCGTGGTT
ATTCCTACTCTAAACCCCCTCATTTACACTTTAAGAAACAAAGATGTGAAGGGAGCTTTG
AAGAGGCTGGTGAGGAAAGATGAAAGCACTGGAAAGCAAATTCTTTCCAAG


Conceptual translation

MTINKSSGGDFILVGFSDQPRLEKILFVVVLISYLLTLVGNTAIILVSCLDSALQTPMYY
FLTNLSFVDICFSTSIVPQLLWNLHGPAKTITATGCAIQLYVSLALGSTECVLLAVMAFD
RYAAVCRPLHYATVMHPRLCQSLAGIAWLSGVGNTLIQGTITLRLPRCGNHRIYHFLCEV
PAMIKLACVDIHANEVQLFMASLVLLLLPLTLILVSYGCITQALMRLRSALTWGKALGTC
GSHLLVVVLFYGTITAVYIQPNSSYAHSRGKFITLLYTVVIPTLNPLIYTLRNKDVKGAL
KRLVRKDESTGKQILSK