Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

Back to all Rat symbols

Rat Or2h16-ps Olfactory Receptor

Gene Symbol Or2h16-ps
Organism Rat
Family 2
Subfamily h
Pseudo Yes
Location chr20:427670-428686 (+)
Aliases Olr1674-ps

Sequence information


Nucleotide sequence

AACAAGTTGCCCAGCCTTGCTTCCTGCCTGCTAGGACATTCACAGAGTTTTGAGCAACCG
TCCTTGTGTCATATCCTGAAGATGCTAATGTCCCAGAAAACACAGAGTTTCCGATGACAC
CCCTGAAGTTTTCATTCTCTGTCTTCCGACAGGCTGTATTTGGAGAAGGTACTTTTGGAG
GGTGATTTTAATCTTTTATTGTTTGACTTTTGCTGGAAATACTGTCACAATTTTCTTTTC
CTCGAAGGACCCCAAACTGCAGATCCCGATGTATTTCTCCCTTTCCAATCTTTCCTTATT
AGATATTTGTTTCACCAGGAGCTGCGTTCCTCAGATGTTGGTTAATTTGGGAAGTCCAAG
GAGAACTATCACCTATCATGGCGGTGCCAGTGACCTTTACAACATCCTGTGGCTTGGCCC
CACTAAATGTATCCTTCTGTTTGCATTGACTGTGTTCCTCTGTGTAGCACTGTGCTGTCT
TCTATGATACATTACTGTCATGCACCTTAAAATCTCTCAGCAGCTGTCTGCCCTTTCCTG
AGGTCCTGGCCTGACTCAGTCCTGATCCAATCTTCTGTGGCCCTCACACTGTCGTTTTGC
TCCCACCTGGTGTGAGATGACATTGTGTGTGAAGTCCCAGCCCGGATTCAGCTCTCAAGT
GCAGATATTGGGTGTAATGAAGTCCAGAGGTCCATCGCCAGTATTATGCTCTTAGTGTTA
CCCTAGGTCACGATCTTTCTTCCTACGGTGCTACTGTGAAGTCTGCGCTGGAGACGAAAG
TCATATGTGGGAGAGAAAATAGCATTTTGCAACTGCATTTCACACCGTCTTGTTCTCTTC
CTCTTCTAAGGTACTGTCACAGTTGTTTACCTTCCACCTAAGACGCATATGCTACCGAAA
GGGCAAGTTTCTCAACCTTTTTTTTAATTGGATATATTTTAAATTTATATTTCCTTTTCC
TGGTTTCCTGTCCAAAAGCCCCCAATCCCATCCTCCTCCACCTGCTTCTATGAGGAT


Conceptual translation

SDRLYLEKV\WRVILIFYCLTFAGNTVTIFFSSKDPKLQIPMYFSLSNLSLLDICFTRS
CVPQMLVNLGSPRRTITYHGGASDLYNILWLGPTKCILLFALTVFLCVALCCLL*YITVM
HLKISQQLSALS*GPGLTQS/IQSSVALTLSFCSHLV*DDIVCEVPARIQLSSADIGCN
EVQRSIASIMLLVLP*VT/LSSYGATVKSAL\RKSYVGEKIAFCNCISHRLVLFLF*G
TVTVVYLPPKT/YAT/KGKFLNLFF