Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

Back to all Rat symbols

Rat Or2h1c-ps Olfactory Receptor

Gene Symbol Or2h1c-ps
Organism Rat
Family 2
Subfamily h
Pseudo Yes
Location chr20:1904641-1905576 (+)
Aliases Olr1747-ps

Sequence information


Nucleotide sequence

ATGGTCAACCAGAGCTCCCCCGTGGGCTTCCTCCTGCTGGGCTTCTCTGAACACCCACAC
CTGGAAAAGATTCTCTTCGTGGTTGTCTTGTGTTCCTACCTCCTCACCCTCCTAGGAAAC
ACACTCATCCTCCTGCTGTCCACACTCGACCCCAGGCTCCACTCTCCAATGTACTTCTTC
CTCTCCAACCTCTCCTTCTTGGACCTCTGTTTCACCACAACCTGTGTCCCCCAGATGCTG
TTCAACCTCTGGGGCCCAACAAAGACCATCAGCTTCCTGGGATGCTCTGTCCAGCTCTTC
ATCTTCATGCTCCTGGGGACGACAGAGTGCATCCTCCTGACAGTAATGGCCTTTGACCGC
TATGTGGCTGTCTGCCAGCCCCTCCACTATACCACCATCATCCACCCACGCCTGTGTCGG
CAGTTGTCAGCTGTGGCCTGGGGTATAGGTTTGGTCCAATCCACAGTTCAGACCCCTCCC
ACCCTCCATCTGCCCTTCTGTTCCCACAGGCAGATAGATAACTTTTTGTGTGAAGTCCCA
TCTCTAATTTGACTCTCTTGTGGGGACACCACTTTTAATGAGATCCAGTTGGCAGTTGCA
GGAGTCATCTTCCTGCTTGTACCTCTGAGCCTCATCCTTGTCTCTTACGGAGTCATTGCC
AGGGCAGTGCTGAAAACTAACTCTTCAAAGGGGCGCAGGAAAGCTTTTGGGACCTGCTCC
TCCCACCTCATCGTGGTCACCCTCTTCTACAGCTCAGTCATTGCTGTCTATCTGCAGCCC
AAAAATCCCTATGCCCAAGAGAGGGGCAAGTTCTTTGGTCTCTTCTGTGCTGTGGGCACC
CCCACATTCAACCCTCTTGTATACACCCTGAGGAACAAGGAGGTGAAGAGAGCATTCTGG
AAGCTGCTGGGGAAGGATGTGGACTCTGGGGAAAGC


Conceptual translation

MVNQSSPVGFLLLGFSEHPHLEKILFVVVLCSYLLTLLGNTLILLLSTLDPRLHSPMYFF
LSNLSFLDLCFTTTCVPQMLFNLWGPTKTISFLGCSVQLFIFMLLGTTECILLTVMAFDR
YVAVCQPLHYTTIIHPRLCRQLSAVAWGIGLVQSTVQTPPTLHLPFCSHRQIDNFLCEVP
SLI*LSCGDTTFNEIQLAVAGVIFLLVPLSLILVSYGVIARAVLKTNSSKGRRKAFGTCS
SHLIVVTLFYSSVIAVYLQPKNPYAQERGKFFGLFCAVGTPTFNPLVYTLRNKEVKRAFW
KLLGKDVDSGES