Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

Back to all Mouse symbols

Mouse Or2h2b-ps Olfactory Receptor

Gene Symbol Or2h2b-ps
Organism Mouse
Family 2
Subfamily h
Pseudo Yes
Location chr17:37169711-37170646 (-)
Aliases Olfr753-ps1, MOR256-38, Olfr92-L

Sequence information


Nucleotide sequence

ATGGTCAACCAGAGCTCCCCTGTGGTCTTCTTCCTGCTGGGCTTCTCTGAACACCCACAA
CTGGAAAAGGTTCTGTTTGTGGTTGTCTTGTGCTCCTACCTCCTCACCCTCTTAGGAAAC
ACACTCATCCTCTTGCTGTCCACCCTGGATCCCAGGCTCCACACTCCAATGTACTTCTTC
CTCTCTAACCTCTCCTTCTTGGACCTCTGCTTCACCACAACCTGTGTCCCCCAGATGCTG
TTCAACCTCTGGGGCCCCGAAAAGACCATCAGCTTCCTGGGATGCTTTGTCTAGCTCTTC
ATCTTCATGTCCCTGGGTACAACAGAGTGCATCCTCCTGACTGTAATGGCCTTTGACCGC
TATGTGGCTGTGTGCCAGCCCCTGCACTATGCCACAGTCATCAACCCCCGCCTATGTCAG
CAGTTGGCAGGTATAGCTTGGGCTATAGGTTTGGTCCAATCCATAGTTCAGACACCTCCC
ACCCTCAAACTGCCATTTTGTTCCCACAGGCAGATAGACAACTTTGTGTGTGAAGTCCCA
TCTCTAATTCAACTCTCTTGTGGAGACATCACATATAATGAGATCCAGATGGCTGTTGCT
AGTATCTTCATTGTGGTTGTGCCTCTGAGTCTCATCCTTGTCTCTTATGGTGCCATTGCC
AGGGCAGTGCTGAAGATAAGCTCTGCAAAGGGGCGCAGGAAAGCTTTTGGGACCTGTTCC
TCCCACCTCATTGTGGTCACTCTCTTCTACAGCTCAGTCATTGCAGTTTATCTGCAGCCC
AAAAACCCTTATGCCCGAGAGAGGGGCAAGTTCTTTGGTCTCTTTTATGCAGTGGGTACC
CCTATACTCAACCCTCTTGTATATACCCTGAGGAACAAGGAGGTAAAAAGAGCATTCTGG
AAGCTGCTAAGGAAAGATGAGGACTCTGAGGAGAGC


Conceptual translation

MVNQSSPVVFFLLGFSEHPQLEKVLFVVVLCSYLLTLLGNTLILLLSTLDPRLHTPMYFF
LSNLSFLDLCFTTTCVPQMLFNLWGPEKTISFLGCFV*LFIFMSLGTTECILLTVMAFDR
YVAVCQPLHYATVINPRLCQQLAGIAWAIGLVQSIVQTPPTLKLPFCSHRQIDNFVCEVP
SLIQLSCGDITYNEIQMAVASIFIVVVPLSLILVSYGAIARAVLKISSAKGRRKAFGTCS
SHLIVVTLFYSSVIAVYLQPKNPYARERGKFFGLFYAVGTPILNPLVYTLRNKEVKRAFW
KLLRKDEDSEES