Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

Back to all Mouse symbols

Mouse Or2h2c Olfactory Receptor

Gene Symbol Or2h2c
Organism Mouse
Family 2
Subfamily h
Pseudo No
Location chr17:37,111,000-37,112,000 (-)
Aliases Olfr92

Sequence information


Nucleotide sequence

MVNQSSPVVFFLLGFSDNPQLEKVLFVVVLCSYLLTLLGNTLILLLSTLDPRLHSPMYFF
LSNLSFLDLCFTTTCVPQMLFNLWGPAKTISFLGCFVQLFIFMSLGTTECILLTVMAFDR
YVAVCQPLHYATKINPHLCRQLAGIAWAIGLVQSIVQTPPTLKLPFCSHRQIDNFLCEVP
SLIQLSCGDTTYNEIQMAVASIFIVVVPLSLILVSYGAIARAVLKISSAKGRRKAFGTCS
SHLIVVTLFYSSVIAVYLQPKNLYARERGKFFGLFYAVGTPTLNPLVYTLRNKEVKRAFW
KLLRKDEDSEES


Conceptual translation

MVNQSSPVVFFLLGFSDNPQLEKVLFVVVLCSYLLTLLGNTLILLLSTLDPRLHSPMYFF
LSNLSFLDLCFTTTCVPQMLFNLWGPAKTISFLGCFVQLFIFMSLGTTECILLTVMAFDR
YVAVCQPLHYATKINPHLCRQLAGIAWAIGLVQSIVQTPPTLKLPFCSHRQIDNFLCEVP
SLIQLSCGDTTYNEIQMAVASIFIVVVPLSLILVSYGAIARAVLKISSAKGRRKAFGTCS
SHLIVVTLFYSSVIAVYLQPKNLYARERGKFFGLFYAVGTPTLNPLVYTLRNKEVKRAFW
KLLRKDEDSEES