Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

Back to all Rat symbols

Rat Or2j5-ps Olfactory Receptor

Gene Symbol Or2j5-ps
Organism Rat
Family 2
Subfamily j
Pseudo Yes
Location chr20:367259-367699 (+)
Aliases Olr1669-ps

Sequence information


Nucleotide sequence

GTTCTTACCTTCCAGAAAATCCTGTGTAGACATCTCCAAGTGGATCACTTCTGTGAAGTG
CCAGCACTGTTGTGGGTTTCCTCTCTTAATATTTGTGCAAATGAGCTGACCCTCATGCTC
ATGAGTGCTATTTTTGTTGTAATATCACTTATTCTCCTTCTGAGCTACTATGGTGTCACT
GCAAGGACTATCCTGAGAATGCAATCAACTGCTTGACTTCAGAAAGTTTTGAAGACCTGT
GGAGCCCATTTTACTGTTGTTTCTCTCTTTTTTTTCCATTCCAATCATGTGTATTTGTCT
TCAGACTTCAAAAAAAAAAAATCTCATGGTCAAGCCAAGTTCAATGCCCTCTTCTATTCT
GTTGTCACACCTAGCCTCAACCCTCTCCTCTATACTCTATGAATCAAAGATTTAGAGACA
CAGTTATAAGACTTACTAGGT


Conceptual translation

VLTFQKILCRHLQVDHFCEVPALLWVSSLNICANELTLMLMSAIFVVISLILLLSYYGVT
ARTILRMQSTA*LQKVLKTCGAHFTVVSLFFFHSNHVYLSSDFKKKKSHGQAKFNALFYS
VVTPSLNPLLYTL*IKDLETQL*DLLG\EADMKEASHVA