Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

Back to all Mouse symbols

Mouse Or2k2 Olfactory Receptor

Gene Symbol Or2k2
Organism Mouse
Family 2
Subfamily k
Pseudo No
Location chr4:58,784,800-58,785,700 (-)
Aliases Olfr267

Sequence information


Nucleotide sequence

MPGENVTVWSLFFLEGFSRYPRLEIVLFVFSLVMYLVTILGNCTLILITVLDSRLQTPMY
LFLGNLSFMDICYTSASIPTLLVNLLSSKKTIIFSGCAVQMYLSLSMGSTECILLAVMAY
DRYVAICNPLRYPIIMNRQVCVQMATISWVTGCLTALLETSFALQIPLCGNIINHFTCEI
LAVLKLACVSSLLMDLVMLVVSILLLPIPMLLICISYGFILSTILRISSTEGRNKAFSTC
GAHLTVVILYYGAALSMYLKPSSSNSQEIDKIISLLYGVLTPMLNPIIYSLRNKEVKDAM
IKLLGKVPLAPSV


Conceptual translation

MPGENVTVWSLFFLEGFSRYPRLEIVLFVFSLVMYLVTILGNCTLILITVLDSRLQTPMY
LFLGNLSFMDICYTSASIPTLLVNLLSSKKTIIFSGCAVQMYLSLSMGSTECILLAVMAY
DRYVAICNPLRYPIIMNRQVCVQMATISWVTGCLTALLETSFALQIPLCGNIINHFTCEI
LAVLKLACVSSLLMDLVMLVVSILLLPIPMLLICISYGFILSTILRISSTEGRNKAFSTC
GAHLTVVILYYGAALSMYLKPSSSNSQEIDKIISLLYGVLTPMLNPIIYSLRNKEVKDAM
IKLLGKVPLAPSV