Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

Back to all Rat symbols

Rat Or2n1e Olfactory Receptor

Gene Symbol Or2n1e
Organism Rat
Family 2
Subfamily n
Pseudo No
Location chr20:321988-322926 (-)
Aliases Olr1668

Sequence information


Nucleotide sequence

ATGGCTGTATCCAATGAAAGCCACCCGAAAGAATTCATCCTCCTGGGCTTTGCTGACCAC
CCTTGGCTGGAACTCCCGCTCTTTGTTACTCTGCTGATCACGTACCCCATGGCTTTGATG
GGGAACATCGCCATCATTCTGGTGTCCACCTTGGATCCTCGTCTCCACAGCCCCATGTAT
TTTTTTCTCAGAAATCTCTCCTTTCTGGACATGTGCTACACCACAAGCGTTGTGCCTCAG
ATGCTGTTTAACCTGGGAAGCTCCAGAAAAACCATCAGTTACGTTGGATGTGTTATCCAA
CTTTATATCTTCCACGTAATGGGTGGCACGGAATGTCTGCTTTTGGCTATCATGTCCATT
GATCGCTACGTGGCTATCTGCAGACCTCTCCACTACACCCTCATCATGAGTCAGCGAGTG
TGCGTCTTGTCAGTGTCTATTATGTGGCTGACTGGAGTGATCTTTGGTTTTTCAGAGGCT
ACACTTACATTACAATTGCCATTGTGTGGCCAATATAAACTGGATCACTTATTGTGTGAA
ATCCCCGTTCTCATAAAAACTGCCTGTGGGGAGAAGGAGTTTAATGAGCTGGCACTTTCT
GTGGTGTGCATTTTCATACTGATTGTTCCTCTGTTCTTAATTCTTGCTTCTTATGTTAAT
ATTGGTCGTGCAGTACTTAGAATTAAATCTTCTGAAGGAAGGAGGAAAGCCTTTGGGACA
TGTTCTTCTCATCTCATTGTAGTTTCTTTATTTTATGGTCCAGGCATGAGCATGTACCTT
CAGCCTCCTTCCTCCATCACAAGGGACCAACCCAAGTTCATGGCTCTCTTTTATGCAGTG
ATAACTCCTACACTGAACCCCTTCATCTATACCCTAAGGAACAAGGATGTAAAGGGTGCC
TTAAAAAAGCTACTGAGAAGCATTTTTAGTTCAAAGTGA


Conceptual translation

MAVSNESHPKEFILLGFADHPWLELPLFVTLLITYPMALMGNIAIILVSTLDPRLHSPMY
FFLRNLSFLDMCYTTSVVPQMLFNLGSSRKTISYVGCVIQLYIFHVMGGTECLLLAIMSI
DRYVAICRPLHYTLIMSQRVCVLSVSIMWLTGVIFGFSEATLTLQLPLCGQYKLDHLLCE
IPVLIKTACGEKEFNELALSVVCIFILIVPLFLILASYVNIGRAVLRIKSSEGRRKAFGT
CSSHLIVVSLFYGPGMSMYLQPPSSITRDQPKFMALFYAVITPTLNPFIYTLRNKDVKGA
LKKLLRSIFSSK