Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

Back to all Rat symbols

Rat Or2n1i Olfactory Receptor

Gene Symbol Or2n1i
Organism Rat
Family 2
Subfamily n
Pseudo No
Location chr20:528089-529135 (-)
Aliases Olr1682

Sequence information


Nucleotide sequence

ATGCCAATCCTGTGTTCCATAGTCATAACCAATGAATTGGGAGGCTTTTCTATTCCTACA
ATAGTAACTTTCTTGATACTTCTTTACTACAGGAGAGTGAGGTTGCAGAGAATGACACTG
ATCAATACAAGTCACCCAGAAGAGTTTATTCTACTTGGTTTTGCAGACCGTCCTTGGCTA
GAACTTCCTCTCTTTATTATTCTTCTGGTAACATACCCCACAGCCATGATTGGAAACATT
GCCATCATTCTGGTGTCCATTTTAGACCCCTGTCTACATAGCCCCATGTATTTCTTCCTC
ACCAACCTCTCCTTTCTGGACATTTGCTACACCACAAGCCTTGTGCCTCAGATGCTAACT
AACCTTGGGGGCTCCACAAAGACCATCAGCTACATGAGTTGTGCAGTTCAGCTCTATTTC
TTCCACACAATGGGGGTCACAGAGTGTATCCTCCTGGCTCTTATGTCCTTTGACCGATAT
GTAGCCATCTGCAAACCACTGCACTATACCCTCATAATGAATCAGCGTAAATGCCTCCTG
TTAGTGTCCATTATGTGGCTGACTGGAATTACCTATGCTGTTACAGAGGCCACTGTAACT
CTGCAATTGCCTCTATGTGGCCACAATAAAATGGATCACTTGGTGTGTGAGATTCCAGTT
CTCATAAAAATTGCTTGTGGTGAAAAAGAAATGAATGAGCTTGCTTTGTCTGTGGTATGC
ATTTTTCTTTCAGCTGTTCCTCTGTGTTTAATTCTTGCCTCCTATGCTAGTATTGGGCAT
GCTGTCTTTAAAATCAAATCTTCAGAGGGAAGGAAAAAGGCCTTTGGGACATGTTCCTCT
CACCTCATTGTGGTTCTCTTGTTCTATGGTCCAGCCATTAGCATGTATCTTCAGCCTCCC
TCCTCTATTACAAAAGACCAACCCAAGTTCATGGCTCTCTTGTATGGAGTAGTAACTCCT
ACACTGAACCCCTTCATCTATACTCTGAGGAACAAGGATGTAAAGGGGGCATTAGGTAAT
CTATTCAGGAATATTTTTATGTCAAAG


Conceptual translation

MPILCSIVITNELGGFSIPTIVTFLILLYYRRVRLQRMTLINTSHPEEFILLGFADRPWL
ELPLFIILLVTYPTAMIGNIAIILVSILDPCLHSPMYFFLTNLSFLDICYTTSLVPQMLT
NLGGSTKTISYMSCAVQLYFFHTMGVTECILLALMSFDRYVAICKPLHYTLIMNQRKCLL
LVSIMWLTGITYAVTEATVTLQLPLCGHNKMDHLVCEIPVLIKIACGEKEMNELALSVVC
IFLSAVPLCLILASYASIGHAVFKIKSSEGRKKAFGTCSSHLIVVLLFYGPAISMYLQPP
SSITKDQPKFMALLYGVVTPTLNPFIYTLRNKDVKGALGNLFRNIFMSK