Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

Back to all Mouse symbols

Mouse Or2r3 Olfactory Receptor

Gene Symbol Or2r3
Organism Mouse
Family 2
Subfamily r
Pseudo No
Location chr6:42,471,200-42,472,200 (-)
Aliases Olfr457

Sequence information


Nucleotide sequence

MKRDNATWVSEFILMGLSSDKHIQAGLFVLFGVIYLLTLLGNGLIVLLIALDPRLHLPMY
FFLCHLSVVDICYTSSGVPQMLAHFLMEKKTISFALCGTQLFFALTLGGTEFLLLAAMAY
DRYVAVCNPLRYTVVMNPRLCMGLAGVSWFVGVVNSAVETAVTMSLPTCGHNVLNHVACE
TLALVRLACVDITLNQVVILASSVVVLLVPCSLVSLSYAHIVAAIMKIRSTQGRRKAFET
CASHLTVVSMSYGMALFTYMQPRSTASAEQDKLVVLFYAVVTPMLNPLIYSLRNKDVKAA
FSRVLMKNIESKN


Conceptual translation

MKRDNATWVSEFILMGLSSDKHIQAGLFVLFGVIYLLTLLGNGLIVLLIALDPRLHLPMY
FFLCHLSVVDICYTSSGVPQMLAHFLMEKKTISFALCGTQLFFALTLGGTEFLLLAAMAY
DRYVAVCNPLRYTVVMNPRLCMGLAGVSWFVGVVNSAVETAVTMSLPTCGHNVLNHVACE
TLALVRLACVDITLNQVVILASSVVVLLVPCSLVSLSYAHIVAAIMKIRSTQGRRKAFET
CASHLTVVSMSYGMALFTYMQPRSTASAEQDKLVVLFYAVVTPMLNPLIYSLRNKDVKAA
FSRVLMKNIESKN