Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

Back to all Rat symbols

Rat Or2r3b Olfactory Receptor

Gene Symbol Or2r3b
Organism Rat
Family 2
Subfamily r
Pseudo No
Location chr4:71892368-71893306 (-)
Aliases Olr803

Sequence information


Nucleotide sequence

ATGGGAGAAAACATGACCTGGGTTAGTGAGTTTATCCTCATGGGTCTCTCCAGTGACAAA
CACATCCAAGCTGGACTCTTTGTCCTCTTTGGGGTCACCTACCTGCTGACTCTGCTGGGC
AATGGGCTCATTGTCCTGCTCATTGCACTGGACCCACGACTCCACCTGCCCATGTACTTC
TTCCTCTGTCACCTGTCAGTGGTAGACATCTGCTATACCTCCAGTGGGGTCCCCCAGATG
CTGGCACACTTCCCCATGGAGAAGAAGACCATCTCTTTTGCTCTATGTGGGACCCAACAC
TTCTTCGCTCTGGCCCTAGGAGGAACTGAGTTCTTGCTGCTGGCTGCCATGGCCTATGAC
CGCTATGTGGCTGTCTGTGATCCACTACGGTACACAGTGGTGATGAGCCCAAGGCTCTGC
ATGGGACTAGCAGGTGTCTCTTGGTTTGTGGGTTTAGTTAATTCTGCTGTGGAGACAGCG
GTCACCATGCGCCTTCCTACCTGTGGGCACAATGTGCTCAACCATGTGGCCTGTGAGACA
CTGGCACTGGTCAGGTTGGCCTGTGTGGACATCACCCTCAACCAAGTGGTGATTCTGGCC
TCTAGTGTGGTGGTGCTGCTGGTGCCCTGCTGCCTGGTCTCTCTGTCCTATGCCCACATT
GTGGCTGCCATCATGAAGATCCGCTCTACCCAGGGACGCCACAAAGCCTTTGAGACCTGT
GCCTCCCACCTGACTGTGGTCTCCATGTCTTATGGGATGGCCCTCTTCACCTACATGCAG
CCCAGTTCCACAGCCTCTGCTGAGCAGGACAAGGTGGTGGTGATCTTCTATGCTTTGGTC
ACCCCTATGCTGAATCCTCTCATCTACAGTCTGAGGAACAAGGATGTAAAGGCTGCTTTC
CATCAAGTTCTGAAGAAGAACTTTGAGTCAAAGAATTAG


Conceptual translation

MGENMTWVSEFILMGLSSDKHIQAGLFVLFGVTYLLTLLGNGLIVLLIALDPRLHLPMYF
FLCHLSVVDICYTSSGVPQMLAHFPMEKKTISFALCGTQHFFALALGGTEFLLLAAMAYD
RYVAVCDPLRYTVVMSPRLCMGLAGVSWFVGLVNSAVETAVTMRLPTCGHNVLNHVACET
LALVRLACVDITLNQVVILASSVVVLLVPCCLVSLSYAHIVAAIMKIRSTQGRHKAFETC
ASHLTVVSMSYGMALFTYMQPSSTASAEQDKVVVIFYALVTPMLNPLIYSLRNKDVKAAF
HQVLKKNFESKN