Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

Back to all Rat symbols

Rat Or2t47e Olfactory Receptor

Gene Symbol Or2t47e
Organism Rat
Family 2
Subfamily t
Pseudo No
Location chr10:44081354-44082313 (-)
Aliases Olr1421

Sequence information


Nucleotide sequence

ATGGGCATCATCACCTGTGTGAACAACTACACTGGACTATCAGATTTCACCCTGGTGGGA
TTCTTAAGTCAATCCAAAGACCCTGTCCTGCTTGCTGTGCTCATATTTGTGGTTTTCCTG
ATGGCCTTGTCTGGAAACGCCCTTCTGATCCTGCTGATACTCTCTGACACCCACCTCCAC
ACACCCATGTACTTTTTTATCGGTCAGCTGTCCCTCATGGACATGATGTACATTTCTGTC
ACTGTGCCCAAGATGCTCATGGACCAGGTGCTGGGGAGCCACAAGATCTCAGCTGCTGCC
TGTGGGATGCAGATGTTCCTCTACCTGACACTAGCAGGTTCTGAATGTTTGCTTCTGGCT
GCCATGTCCTATGACCGCTATGTGGCCATCTGCCATCCACTCCGGTATCCTATCCTCATG
AACCACAGGGTGTGTCTCCTTCTGTTGTCTGTCTGTTGGCTCCTGGGATCCTTGGATGGC
TTCATATTCACCCCTGTCACCATGACATTCCCATTCTGTGGATCACGGAAGATCTATCAC
TTCTTCTGTGAGGTTCCTGCTGTGACAAAGCTCTCCTGCTCAGACACCTGGCTCTATGAG
ACCTTCATGTATGTGTGCTGTGTGATCATGCTTCTCATTCCTGTTACAGTCATTTCAGGA
TCCTACTTATCCATCCTCCTCACTGTTCTGAGGATGAACTCAACAGAGGGCAGGAAGAAG
GCTCTTGCCACCTGCTCCTCCCATATGATGGTGGTCATCCTCTTCTATGGAGCTGCTGTC
TATAACTACATGCTACCTATCTCGTTCCACACCCCTGAGAAGAACATGGTGGTGTCTGCA
TTTTACACCATACTCACACCTCTGTTGAACCCACTAATCTACAGTTTTAGGAATAAGAAT
GTCAATAAGGCTTTGAGTAAATTGTTAGATGTAAGCACCATCTTCCAAAAAACTGTAAAG


Conceptual translation

MGIITCVNNYTGLSDFTLVGFLSQSKDPVLLAVLIFVVFLMALSGNALLILLILSDTHLH
TPMYFFIGQLSLMDMMYISVTVPKMLMDQVLGSHKISAAACGMQMFLYLTLAGSECLLLA
AMSYDRYVAICHPLRYPILMNHRVCLLLLSVCWLLGSLDGFIFTPVTMTFPFCGSRKIYH
FFCEVPAVTKLSCSDTWLYETFMYVCCVIMLLIPVTVISGSYLSILLTVLRMNSTEGRKK
ALATCSSHMMVVILFYGAAVYNYMLPISFHTPEKNMVVSAFYTILTPLLNPLIYSFRNKN
VNKALSKLLDVSTIFQKTVK