Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

Back to all Rat symbols

Rat Or2t48-ps Olfactory Receptor

Gene Symbol Or2t48-ps
Organism Rat
Family 2
Subfamily t
Pseudo Yes
Location chr10:44025637-44026344 (-)
Aliases Olr1418

Sequence information


Nucleotide sequence

ATGCTCATGAACCAGATGCTGGAGAACTACAGGATCTCAGCTGCTGCCTGTGGGATGCAG
ATGTTCCTCTACCTGACACTAGCAGGTTCAGAATTCTTGCTTCTAGCTGCCATGTCTTAT
GACCGCTATGTGGCCATCTGCCATCCACTCCGGTATCATGTCCTCATGAACCACAGGGTG
TGTATCCTCCTGGTATATTCCTGTTGGCTCCTGGGATCCTTAGATGGCTTCATATTCACC
CCTGTCACCATGACCTTCCCATTCTGTGGGTCACGGGAGATCTATCACTTCTACTGTGAG
GTTCTGGCTGTGACAAAGCTCTCCTGCTCAGACACCTGGCTCTATGAGACCTTAATGTAT
GTGTGCTGTGTGATCATGCTTCTCATCCCTGTGACAGTCATTTCAGGATCCTACTCATCC
ATCCTCCTCACTGTTCTCAGGATGAACTCAACAGAGGGCAGGAAGAAGGCTCTTGCAACA
TGCTCCTCCCACATGACTGTGGTCATCATCTTCTATGGCACTGCTATCTATAACTACATG
CTCCCTGCCTCCCTCCACACTCCTGAGAAGGACATGGTGGTGTCTGTGTTTTATACCATA
CTCACACCACTGTTGAACCCACTAATATATAGTTTTAGGAATAAGAATGTCACTGAGGCT
ATGCGGAAATGGTTTGGTATGAGCACCCTCTTCCAACAAATTGTAAAG


Conceptual translation

MLMNQMLENYRISAAACGMQMFLYLTLAGSEFLLLAAMSYDRYVAICHPLRYHVLMNHRV
CILLVYSCWLLGSLDGFIFTPVTMTFPFCGSREIYHFYCEVLAVTKLSCSDTWLYETLMY
VCCVIMLLIPVTVISGSYSSILLTVLRMNSTEGRKKALATCSSHMTVVIIFYGTAIYNYM
LPASLHTPEKDMVVSVFYTILTPLLNPLIYSFRNKNVTEAMRKWFGMSTLFQQIVK