Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

Back to all Rat symbols

Rat Or2w25 Olfactory Receptor

Gene Symbol Or2w25
Organism Rat
Family 2
Subfamily w
Pseudo No
Location chr10:45966926-45967828 (+)
Aliases Olr1464-ps

Sequence information


Nucleotide sequence

ATGGAGAGAAGCAATGAGAGCTCTGGGGACTTTATTCTCCTGGGCTTCTCAGACCAGCCC
AGGCTGGAGATGGTCCTCTTTGTTGTCTGTATGGTCTTTTACTTCCTGGCCGTCACAGGC
AACTCAACCATCATCTTCCTTTCCCTTGTGGACCTCCGGCTACACACACCCATGTACTTC
TTCCTCAGCAACCTGTCCCTTCTTGACCTCTGCTACACAAGCAGCAGCATCCCCCAGTTC
CAGGTTAACCTCTGGGGCCCACAAAAGACCATAAGCTTCGTGGGCTGTGCCATTCAACTC
TTTGCCTTTCTGTCTGTGCGGGGCGTCGAGTGCATTCTCCTATCCGTTATGGCCTATGAC
CGCTTTGTAGCTGTCTGCAAGCCACTGCATTACCTAACCATCATGTACCCACAGCTGTGC
CTGAAGCTGGCAGCCTTTGCCTGGCTCAGTGGTATTGCCAGCTCCACACTGATGTCCCCA
TTGACCATGTCTCTGGGGCGGTGTGGGCATCGCCGTATCAACCACTTTGTGTGCGAGATG
CCGGCCATCATCCACATCTCTTGTGTGGACACAAGCTGGGTAGAAGGCCTAGTTTTCATC
CTGGCCATCCCTATTGTCCTCGTGCCTCTCACTATGATCCTGGTCTCCTATGGCTACATT
GCTGTCGCCGTCCTGAGGATCAAGTCCACAGCTAGTCGGCGCAAGGCCTTCAACACCTGC
TCTTCACACATGGTGGTGGTGTCTCTTTTCTACAGTAGCATCATCTACATGTACATGCAG
CCTGGCAACGCAGCAAGCCAGGATCAGGGCAAGTTTCTTTTTCTTTTTTTTTTTTTCTTT
TTTCTATTTTTCGGAGCTGGCCGAACCCAGGGCCTTGCGTTTGCTAGGCAAGCGCTCTAC
CAC


Conceptual translation

MERSNESSGDFILLGFSDQPRLEMVLFVVCMVFYFLAVTGNSTIIFLSLVDLRLHTPMYF
FLSNLSLLDLCYTSSSIPQFQVNLWGPQKTISFVGCAIQLFAFLSVRGVECILLSVMAYD
RFVAVCKPLHYLTIMYPQLCLKLAAFAWLSGIASSTLMSPLTMSLGRCGHRRINHFVCEM
PAIIHISCVDTSWVEGLVFILAIPIVLVPLTMILVSYGYIAVAVLRIKSTASRRKAFNTC
SSHMVVVSLFYSSIIYMYMQPGNAASQDQGKFLFLFFFFFFLFFGAGRTQGLAFARQALY
H